UniProtKB/Swiss-Prot Q9H611: Variant p.Ile640Asn

ATP-dependent DNA helicase PIF1
Gene: PIF1
Feedback?

Variant information Variant position:

640 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Type of variant:

LB/B The variants are classified into three categories: LP/P, LB/B and US.

LP/P: likely pathogenic or pathogenic.
LB/B: likely benign or benign.
US: uncertain significance

Residue change:

From Isoleucine (I) to Asparagine (N) at position 640 (I640N, p.Ile640Asn). Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.
Physico-chemical properties:

Change from medium size and hydrophobic (I) to medium size and polar (N) The physico-chemical property of the reference and variant residues and the change implicated.
BLOSUM score:

-3 The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:

Lowest score: -4 (low probability of substitution).
Highest score: 11 (high probability of substitution).

More information can be found on the following page
Other resources:

Links to websites of interest for the variant.

Variant rs17802279 [ dbSNP | Ensembl ]

Sequence information Variant position:

640 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Protein sequence length:

641 The length of the canonical sequence.
Location on the sequence:

LSLESPDDDEAASDQENMDP I L The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.
Residue conservation:

The multiple alignment of the region surrounding the variant against various orthologous sequences.

Human                         LSLESPDDDEAASDQENMDPIL-----------------------------------------------------

Mouse                         LSLESQDDEEANSDLENMDPNL

Rat                           LSLESQDDEEASSDLENMDPNL

Xenopus laevis                LRQTSLDDFL---DKENC----

Zebrafish                     LMQSSMNDFVGQSNKENSRW--

Baker's yeast                 LDYAPGPKYKAKSKSKSNSPAP

Fission yeast                 LPIRNENKAPVQMRGVKNK---

Sequence annotation in neighborhood:

The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:

Type: the type of sequence feature.
Positions: endpoints of the sequence feature.
Description: contains additional information about the feature.

Type	Positions	Description
Chain	1 – 641	ATP-dependent DNA helicase PIF1
Region	167 – 641	Hydrolyzes ATP in the presence of both magnesium and single-stranded DNA; weak activity in the presence of RNA or double-stranded DNA; No unwinding activity
Region	622 – 641	Disordered
Alternative sequence	267 – 641	Missing. In isoform 2.
Alternative sequence	623 – 641	ESPDDDEAASDQENMDPIL -> AAEGRGNEDRCSGSSIRALGGDWWGLRLGAASKQRTELRCVSTARPSLAQPRTNTLQSLTKEHKLQNVHPYFKLLFQGINSVWGH. In isoform 3.

Literature citations
No reference for the current variant in UniProtKB/Swiss-Prot.

Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.