UniProtKB/Swiss-Prot Q13835: Variant p.Arg116His

Plakophilin-1
Gene: PKP1
Feedback?

Variant information Variant position:

116 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Type of variant:

LB/B The variants are classified into three categories: LP/P, LB/B and US.

LP/P: likely pathogenic or pathogenic.
LB/B: likely benign or benign.
US: uncertain significance

Residue change:

From Arginine (R) to Histidine (H) at position 116 (R116H, p.Arg116His). Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.
Physico-chemical properties:

Change from large size and basic (R) to medium size and polar (H) The physico-chemical property of the reference and variant residues and the change implicated.
BLOSUM score:

0 The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:

Lowest score: -4 (low probability of substitution).
Highest score: 11 (high probability of substitution).

More information can be found on the following page
Other resources:

Links to websites of interest for the variant.

Variant rs34626929 [ dbSNP | Ensembl ]

Sequence information Variant position:

116 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Protein sequence length:

747 The length of the canonical sequence.
Location on the sequence:

NGSWGYPIYNGTLKREPDNR R FSSYSQMENWSRHYPRGSCN The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.
Residue conservation:

The multiple alignment of the region surrounding the variant against various orthologous sequences.

Human                         NGSWGYPIYNGTLKREPDNRRFSSYSQMENWSRHYPRGSCN

Mouse                         NGSWGYPIYNGTLKREPDNRRFSSYSQMENWSRHYPRGSCA

Bovine                        SGSWGYPIYNGTLKREADNRRFSSYSQMESWGRQYPRGGCT

Sequence annotation in neighborhood:

The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:

Type: the type of sequence feature.
Positions: endpoints of the sequence feature.
Description: contains additional information about the feature.

Type	Positions	Description
Chain	1 – 747	Plakophilin-1
Region	1 – 286	Required for interaction with EIF4A1
Region	1 – 234	Required for binding to single stranded DNA
Region	116 – 191	Phosphorylation in this region is required for cytoplasmic localization and protein stabilization
Modified residue	118 – 118	Phosphoserine; by PKB/AKT2
Modified residue	119 – 119	Phosphoserine
Modified residue	121 – 121	Phosphoserine
Mutagenesis	118 – 118	S -> A. Reduces the interaction with YWHAG.
Mutagenesis	119 – 119	S -> A. Reduces the interaction with YWHAG.

Literature citations
No reference for the current variant in UniProtKB/Swiss-Prot.

Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.