UniProtKB/Swiss-Prot P16050: Variant p.Thr560Met

Polyunsaturated fatty acid lipoxygenase ALOX15
Gene: ALOX15
Feedback?

Variant information Variant position:

560 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Type of variant:

LB/B The variants are classified into three categories: LP/P, LB/B and US.

LP/P: likely pathogenic or pathogenic.
LB/B: likely benign or benign.
US: uncertain significance

Residue change:

From Threonine (T) to Methionine (M) at position 560 (T560M, p.Thr560Met). Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.
Physico-chemical properties:

Change from medium size and polar (T) to medium size and hydrophobic (M) The physico-chemical property of the reference and variant residues and the change implicated.
BLOSUM score:

-1 The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:

Lowest score: -4 (low probability of substitution).
Highest score: 11 (high probability of substitution).

More information can be found on the following page
Variant description:

Loss of catalytic activity; Loss of arachidonate 15-lipoxygenase activity.. Any additional useful information about the variant.
Other resources:

Links to websites of interest for the variant.

Variant rs34210653 [ dbSNP | Ensembl ]

Sequence information Variant position:

560 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Protein sequence length:

662 The length of the canonical sequence.
Location on the sequence:

HASVHLGQLDWYSWVPNAPC T MRLPPPTTKDATLETVMATL The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.
Residue conservation:

The multiple alignment of the region surrounding the variant against various orthologous sequences.

Human                         HASVHLGQLDWYSWVPNAPCTMRLPPPTTKDATLETVMATL

Mouse                         HSSIHLGQLDWFYWVPNAPCTMRLPPPKTKDATMEKLMATL

Rat                           HSSVHLGQLDWFYWVPNAPCTMRLPPPTTKEATMEKLMATL

Pig                           HSSNHLGQLDWYSWVPNAPCTMRLPPPTTKDATLETVMATL

Bovine                        HSSTHLGQLDWYSWVPNAPCTMRLPPPTTKDVTLEKVMATL

Rabbit                        HSSIHLGQLDWFTWVPNAPCTMRLPPPTTKDATLETVMATL

Sequence annotation in neighborhood:

The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:

Type: the type of sequence feature.
Positions: endpoints of the sequence feature.
Description: contains additional information about the feature.

Type	Positions	Description
Chain	2 – 662	Polyunsaturated fatty acid lipoxygenase ALOX15
Domain	115 – 662	Lipoxygenase
Binding site	540 – 540
Binding site	544 – 544

Literature citations
Functional characterization of genetic enzyme variations in human lipoxygenases.
Horn T.; Reddy Kakularam K.; Anton M.; Richter C.; Reddanna P.; Kuhn H.;
Redox Biol. 1:566-577(2013)
Cited for: CATALYTIC ACTIVITY; FUNCTION; BIOPHYSICOCHEMICAL PROPERTIES; VARIANTS GLN-205; TRP-402; ARG-422; GLU-422; MET-560 AND SER-617; CHARACTERIZATION OF VARIANTS GLN-205; TRP-402; ARG-422; GLU-422; MET-560 AND SER-617; A near null variant of 12/15-LOX encoded by a novel SNP in ALOX15 and the risk of coronary artery disease.
Assimes T.L.; Knowles J.W.; Priest J.R.; Basu A.; Borchert A.; Volcik K.A.; Grove M.L.; Tabor H.K.; Southwick A.; Tabibiazar R.; Sidney S.; Boerwinkle E.; Go A.S.; Iribarren C.; Hlatky M.A.; Fortmann S.P.; Myers R.M.; Kuhn H.; Risch N.; Quertermous T.;
Atherosclerosis 198:136-144(2008)
Cited for: VARIANT MET-560; CHARACTERIZATION OF VARIANT MET-560; INVOLVEMENT IN CORONARY ARTERY DISEASE;

Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.