Home  |  Contact

UniProtKB/Swiss-Prot P48634: Variant p.Thr1087Ile

Protein PRRC2A
Gene: PRRC2A
Variant information

Variant position:  1087
The position of the amino-acid change on the UniProtKB canonical protein sequence.

Type of variant:  US
The variants are classified into three categories: LP/P, LB/B and US.
  • LP/P: likely pathogenic or pathogenic.
  • LB/B: likely benign or benign.
  • US: uncertain significance

Residue change:  From Threonine (T) to Isoleucine (I) at position 1087 (T1087I, p.Thr1087Ile).
Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.

Physico-chemical properties:  Change from medium size and polar (T) to medium size and hydrophobic (I)
The physico-chemical property of the reference and variant residues and the change implicated.

BLOSUM score:  -1
The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:
  • Lowest score: -4 (low probability of substitution).
  • Highest score: 11 (high probability of substitution).
More information can be found on the following page

Variant description:  In a breast cancer sample; somatic mutation.
Any additional useful information about the variant.

Other resources:  
Links to websites of interest for the variant.



Sequence information

Variant position:  1087
The position of the amino-acid change on the UniProtKB canonical protein sequence.

Protein sequence length:  2157
The length of the canonical sequence.

Location on the sequence:   GGGTGGPNHPPAPRGRTASE  T RSEGSEYEEIPKRRRQRGSE
The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.

Residue conservation: 
The multiple alignment of the region surrounding the variant against various orthologous sequences.

Human                         GGGTGGPNHPPAPRGRTASETRSEGSEYEEIPKRRRQRGSE

Rhesus macaque                GGGTGGPNHPPAPRGRTASETRSEGSEYEEIPKRRRQRGSE

Mouse                         GGGSGGTNHPSAPRGRTASETRSEGSEYEEIPKRRRQRGSE

Rat                           GGGSGGTNHPSAPRGRTASETRSEGSEYEEIPKRRRQRGSE

Sequence annotation in neighborhood:  
The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:
  • Type: the type of sequence feature.
  • Positions: endpoints of the sequence feature.
  • Description: contains additional information about the feature.

TypePositionsDescription
Chain 1 – 2157 Protein PRRC2A
Region 41 – 1812 4 X 57 AA type A repeats
Region 740 – 1775 Disordered
Compositional bias 1086 – 1123 Basic and acidic residues
Modified residue 1083 – 1083 Phosphothreonine
Modified residue 1085 – 1085 Phosphoserine
Modified residue 1089 – 1089 Phosphoserine
Modified residue 1092 – 1092 Phosphoserine
Modified residue 1094 – 1094 Phosphotyrosine
Modified residue 1106 – 1106 Phosphoserine
Alternative sequence 834 – 1457 Missing. In isoform 4.
Alternative sequence 1050 – 1148 RSREFRSYREFRGDDGRGGGTGGPNHPPAPRGRTASETRSEGSEYEEIPKRRRQRGSETGSETHESDLAPSDKEAPTPKEGTLTQVPLAPPPPGAPPSP -> QANSAVTESFEEMMGVEVGQGDQTTLLLPEAAMPARHGARVQSMRKSPSGAGSGAQKQAARPMRVIWLLQTRRLPHPRREHSPRSSRSPTTRSPTLHR. In isoform 2 and isoform 3.


Literature citations

The consensus coding sequences of human breast and colorectal cancers.
Sjoeblom T.; Jones S.; Wood L.D.; Parsons D.W.; Lin J.; Barber T.D.; Mandelker D.; Leary R.J.; Ptak J.; Silliman N.; Szabo S.; Buckhaults P.; Farrell C.; Meeh P.; Markowitz S.D.; Willis J.; Dawson D.; Willson J.K.V.; Gazdar A.F.; Hartigan J.; Wu L.; Liu C.; Parmigiani G.; Park B.H.; Bachman K.E.; Papadopoulos N.; Vogelstein B.; Kinzler K.W.; Velculescu V.E.;
Science 314:268-274(2006)
Cited for: VARIANTS [LARGE SCALE ANALYSIS] ILE-1087 AND HIS-1152;

Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.