Home  |  Contact

UniProtKB/Swiss-Prot Q96S37: Variant p.Thr217Met

Solute carrier family 22 member 12
Gene: SLC22A12
Variant information

Variant position:  217
The position of the amino-acid change on the UniProtKB canonical protein sequence.

Type of variant:  LP/P [Disclaimer]
The variants are classified into three categories: LP/P, LB/B and US.
  • LP/P: likely pathogenic or pathogenic.
  • LB/B: likely benign or benign.
  • US: uncertain significance

Residue change:  From Threonine (T) to Methionine (M) at position 217 (T217M, p.Thr217Met).
Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.

Physico-chemical properties:  Change from medium size and polar (T) to medium size and hydrophobic (M)
The physico-chemical property of the reference and variant residues and the change implicated.

BLOSUM score:  -1
The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:
  • Lowest score: -4 (low probability of substitution).
  • Highest score: 11 (high probability of substitution).
More information can be found on the following page

Variant description:  In RHUC1; strongly reduced urate transport.
Any additional useful information about the variant.

Other resources:  
Links to websites of interest for the variant.



Sequence information

Variant position:  217
The position of the amino-acid change on the UniProtKB canonical protein sequence.

Protein sequence length:  553
The length of the canonical sequence.

Location on the sequence:   PVYCLFRFLLAFAVAGVMMN  T GTLLMEWTAARARPLVMTLN
The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.

Residue conservation: 
The multiple alignment of the region surrounding the variant against various orthologous sequences.

Human                         PVYCLFRFLLAFAVAGVMMNTGTLLMEWTAARARPLVMTLN

Mouse                         PLYCLFRFLLASAVAGVMMNTASLLMEWTSAQGSPLVMTLN

Rat                           PLYCLFRFLVASAVAGVMMNTASLLMEWTSAQAGPLMMTLN

Sequence annotation in neighborhood:  
The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:
  • Type: the type of sequence feature.
  • Positions: endpoints of the sequence feature.
  • Description: contains additional information about the feature.

TypePositionsDescription
Chain 1 – 553 Solute carrier family 22 member 12
Alternative sequence 1 – 221 Missing. In isoform 3.
Alternative sequence 170 – 277 Missing. In isoform 2.
Alternative sequence 187 – 221 GTAAAFAPAFPVYCLFRFLLAFAVAGVMMNTGTLL -> V. In isoform 4.


Literature citations

Molecular identification of a renal urate anion exchanger that regulates blood urate levels.
Enomoto A.; Kimura H.; Chairoungdua A.; Shigeta Y.; Jutabha P.; Cha S.H.; Hosoyamada M.; Takeda M.; Sekine T.; Igarashi T.; Matsuo H.; Kikuchi Y.; Oda T.; Ichida K.; Hosoya T.; Shimokata K.; Niwa T.; Kanai Y.; Endou H.;
Nature 417:447-452(2002)
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1); FUNCTION; TISSUE SPECIFICITY; SUBCELLULAR LOCATION; VARIANTS RHUC1 MET-217 AND ASP-298; CHARACTERIZATION OF VARIANTS RHUC1 MET-217 AND ASP-298;

Clinical and molecular analysis of patients with renal hypouricemia in Japan-influence of URAT1 gene on urinary urate excretion.
Ichida K.; Hosoyamada M.; Hisatome I.; Enomoto A.; Hikita M.; Endou H.; Hosoya T.;
J. Am. Soc. Nephrol. 15:164-173(2004)
Cited for: VARIANTS RHUC1 HIS-90; MET-138; SER-164; MET-217; LEU-382 AND THR-430; CHARACTERIZATION OF VARIANTS RHUC1 HIS-90; MET-138; SER-164; MET-217; LEU-382 AND THR-430;

Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.