Home  |  Contact

UniProtKB/Swiss-Prot O14746: Variant p.Arg865His

Telomerase reverse transcriptase
Gene: TERT
Chromosomal location: 5p15.33
Variant information

Variant position:  865
The position of the amino-acid change on the UniProtKB canonical protein sequence.

Type of variant:  Disease [Disclaimer]
The variants are classified into three categories: Disease, Polymorphism and Unclassified.
  • Disease: Variants implicated in disease according to literature reports.
  • Polymorphism: Variants not reported to be implicated in disease.
  • Unclassified: Variants with uncertain implication in disease according to literature reports. Evidence against or in favor of a pathogenic role is limited and/or conflicting.

Residue change:  From Arginine (R) to Histidine (H) at position 865 (R865H, p.Arg865His).
Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.

Physico-chemical properties:  Change from large size and basic (R) to medium size and polar (H)
The physico-chemical property of the reference and variant residues and the change implicated.

BLOSUM score:  0
The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:
  • Lowest score: -4 (low probability of substitution).
  • Highest score: 11 (high probability of substitution).
More information can be found on the following page

Involvement in disease:  Pulmonary fibrosis, and/or bone marrow failure, telomere-related, 1 (PFBMFT1) [MIM:614742]: A disease associated with shortened telomeres. Pulmonary fibrosis is the most common manifestation. Other manifestations include aplastic anemia due to bone marrow failure, hepatic fibrosis, and increased cancer risk, particularly myelodysplastic syndrome and acute myeloid leukemia. Phenotype, age at onset, and severity are determined by telomere length. {ECO:0000269|PubMed:15814878, ECO:0000269|PubMed:17460043, ECO:0000269|PubMed:21436073, ECO:0000269|PubMed:21483807, ECO:0000269|PubMed:22512499}. Note=The disease is caused by mutations affecting the gene represented in this entry.
The name and a short description of the disease associated with the variant. For more information about the disease, the user can refer to OMIM, following the link provided after the disease acronym.

Variant description:  In PFBMFT1.
Any additional useful information about the variant.

Other resources:  
Links to websites of interest for the variant.



Sequence information

Variant position:  865
The position of the amino-acid change on the UniProtKB canonical protein sequence.

Protein sequence length:  1132
The length of the canonical sequence.

Location on the sequence:   CYGDMENKLFAGIRRDGLLL  R LVDDFLLVTPHLTHAKTFLR
The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.

Residue conservation: 
The multiple alignment of the region surrounding the variant against various orthologous sequences.

Human                         CYGDMENKL--FAGIRRDG-LLLRLVDDFLLVTPHLTHAKTFLR

                              CYGDMERRL--FPGIEQDG-VLLRLVDDFLLVTPHLTQAQA

Mouse                         CFGDMENKL--FAEVQRDG-LLLRFVDDFLLVTPHLDQAKT

Rat                           CFGDMENKL--FAEVQQDG-LLLRFVDDFLLVTPHLAHAKA

Bovine                        CYGDMENKL--FPGVQQDG-VLLRLVDDFLLVTPHLTRARD

Baker's yeast                 VYDDLLEFYSEFKASPSQDTLILKLADDFLIISTDQQQVIN

Fission yeast                 YMEDLIDEY--LSFTKKKGSVLLRVVDDFLFITVNKKDAKK

Sequence annotation in neighborhood:  
The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:
  • Type: the type of sequence feature.
  • Positions: endpoints of the sequence feature.
  • Description: contains additional information about the feature.

TypePositionsDescription
Chain 1 – 1132 Telomerase reverse transcriptase
Domain 605 – 935 Reverse transcriptase
Metal binding 868 – 868 Magnesium; catalytic
Metal binding 869 – 869 Magnesium; catalytic
Site 867 – 867 Required for nucleotide incorporation and primer extension rate
Alternative sequence 808 – 1132 Missing. In isoform 2 and isoform 4.
Mutagenesis 866 – 866 L -> Y. Moderate reduction in telomerase activity, no change in repeat extension rate nor on nucleotide incorporation fidelity. Little further reduction in activity but 13.5-fold increase in nucleotide incorporation fidelity; when associated with M-867.
Mutagenesis 867 – 867 V -> A. About 75% reduction in telomerase activity, about 80% reduction in repeat reduction rate and 3.9-fold increase in nucleotide incorporation fidelity.
Mutagenesis 867 – 867 V -> M. About 75% reduction in telomerase activity, about 50% reduction in repeat extension rate and 5.2-fold increase in nucleotide incorporation fidelity. Little further reduction in activity and 13.5-fold increase in nucleotide incorporation fidelity; when associated with Y-866.
Mutagenesis 867 – 867 V -> T. Severe reduction in telomerase activity, about 50% reduction in repeat extension rate and 2.2-fold increase in nucleotide incorporation fidelity. No further reduction in activity but 2.8-fold increase in nucleotide incorporation fidelity; when associated with Y-866.
Mutagenesis 868 – 868 D -> A. Loss of telomerase activity.
Mutagenesis 869 – 869 D -> A. Loss of telomerase activity.


Literature citations

Adult-onset pulmonary fibrosis caused by mutations in telomerase.
Tsakiri K.D.; Cronkhite J.T.; Kuan P.J.; Xing C.; Raghu G.; Weissler J.C.; Rosenblatt R.L.; Shay J.W.; Garcia C.K.;
Proc. Natl. Acad. Sci. U.S.A. 104:7552-7557(2007)
Cited for: VARIANT PFBMFT1 HIS-865;

Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.