Expasy logo

UniProtKB/Swiss-Prot variant pages

UniProtKB/Swiss-Prot A1L4L8: Variant p.Cys11Ser

PLAC8-like protein 1
Gene: PLAC8L1
Feedback?
Variant information Variant position: help 11
Type of variant: help LB/B
Residue change: help From Cysteine (C) to Serine (S) at position 11 (C11S, p.Cys11Ser).
Physico-chemical properties: help Change from medium size and polar (C) to small size and polar (S)
BLOSUM score: help -1
Other resources: help


Sequence information Variant position: help 11
Protein sequence length: help 177
Location on the sequence: help MNWFGSNFFR C PEDLSLLNIYSPLLSHMSSE
Residue conservation: help
Human                         MNWFGSNFFRCPEDLSLLNIYSPLLSHMSSE

Mouse                         MSWMGHHFSRWCKDISVLSSHLPLFSPMPSE

Sequence annotation in neighborhood: help
TypePositionsDescription
Chain 1 – 177 PLAC8-like protein 1



Literature citations
No reference for the current variant in UniProtKB/Swiss-Prot.
Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.