Home  |  Contact

UniProtKB/Swiss-Prot O60931: Variant p.Asn177Thr

Cystinosin
Gene: CTNS
Chromosomal location: 17p13
Variant information

Variant position:  177
The position of the amino-acid change on the UniProtKB canonical protein sequence.

Type of variant:  Disease [Disclaimer]
The variants are classified into three categories: Disease, Polymorphism and Unclassified.
  • Disease: Variants implicated in disease according to literature reports.
  • Polymorphism: Variants not reported to be implicated in disease.
  • Unclassified: Variants with uncertain implication in disease according to literature reports. Evidence against or in favor of a pathogenic role is limited and/or conflicting.

Residue change:  From Asparagine (N) to Threonine (T) at position 177 (N177T, p.Asn177Thr).
Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.

Physico-chemical properties:  Similar physico-chemical property. Both residues are medium size and polar.
The physico-chemical property of the reference and variant residues and the change implicated.

BLOSUM score:  0
The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:
  • Lowest score: -4 (low probability of substitution).
  • Highest score: 11 (high probability of substitution).
More information can be found on the following page

Involvement in disease:  Cystinosis, late-onset juvenile or adolescent nephropathic type (CTNSJAN) [MIM:219900]: A form of cystinosis, a lysosomal storage disease due to defective transport of cystine across the lysosomal membrane. This results in cystine accumulation and crystallization in the cells causing widespread tissue damage. Late-onset juvenile or adolescent nephropathic cystinosis is an intermediated form, manifesting first at age 10 to 12 years with proteinuria due to glomerular damage rather than with the manifestations of tubular damage that occur first in infantile cystinosis. There is no excess amino aciduria and stature is normal. Photophobia, late development of pigmentary retinopathy, and chronic headaches are features. {ECO:0000269|PubMed:10444339, ECO:0000269|PubMed:12442267, ECO:0000269|PubMed:9792862}. Note=The disease is caused by mutations affecting the gene represented in this entry.
The name and a short description of the disease associated with the variant. For more information about the disease, the user can refer to OMIM, following the link provided after the disease acronym.

Variant description:  In CTNSJAN.
Any additional useful information about the variant.



Sequence information

Variant position:  177
The position of the amino-acid change on the UniProtKB canonical protein sequence.

Protein sequence length:  367
The length of the canonical sequence.

Location on the sequence:   GLSFDFVALNLTGFVAYSVF  N IGLLWVPYIKEQFLLKYPNG
The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.

Residue conservation: 
The multiple alignment of the region surrounding the variant against various orthologous sequences.

Human                         GLSFDFVALNLTGFVAYSVFNIGLLWVPYIKEQFLLKYPNG

Mouse                         GLSFDFLALNLTGFVAYSVFNIGLLWVPYIQEEFLLKYPNG

Bovine                        GLSFDFVVLNLMGFVAYSVFNIGLFWVPSIKEQFLLKYPNG

Caenorhabditis elegans        GLNFDFLSLNLVGFCAYAIFNLLMYYNSHVKNEYNIVNPRS

Drosophila                    GLNFDFLALNIVGFTLYSMFNCGLYFIEDLQNEYEVRYPLG

Slime mold                    GLSFDFLLFNITGYACYSVFNSVLYFDKLVKNEYYDKY--G

Sequence annotation in neighborhood:  
The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:
  • Type: the type of sequence feature.
  • Positions: endpoints of the sequence feature.
  • Description: contains additional information about the feature.

TypePositionsDescription
Chain 1 – 367 Cystinosin
Transmembrane 162 – 182 Helical
Domain 123 – 189 PQ-loop 1


Literature citations

Identification of 14 novel CTNS mutations and characterization of seven splice site mutations associated with cystinosis.
Kalatzis V.; Cohen-Solal L.; Cordier B.; Frishberg Y.; Kemper M.; Nuutinen E.M.; Legrand E.; Cochat P.; Antignac C.;
Hum. Mutat. 20:439-446(2002)
Cited for: VARIANTS CTNS VAL-110; ARG-222; LYS-288; ASP-346--349-PHE DEL AND ASP-VAL-GLU-PHE-349 INS; VARIANTS CTNSJAN THR-177 AND LEU-200;

Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.