Home  |  Contact

UniProtKB/Swiss-Prot P10636: Variant p.Lys634Met

Microtubule-associated protein tau
Gene: MAPT
Variant information

Variant position:  634
The position of the amino-acid change on the UniProtKB canonical protein sequence.

Type of variant:  Disease [Disclaimer]
The variants are classified into three categories: Disease, Polymorphism and Unclassified.
  • Disease: Variants implicated in disease according to literature reports.
  • Polymorphism: Variants not reported to be implicated in disease.
  • Unclassified: Variants with uncertain implication in disease according to literature reports. Evidence against or in favor of a pathogenic role is limited and/or conflicting.

Residue change:  From Lysine (K) to Methionine (M) at position 634 (K634M, p.Lys634Met).
Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.

Physico-chemical properties:  Change from large size and basic (K) to medium size and hydrophobic (M)
The physico-chemical property of the reference and variant residues and the change implicated.

BLOSUM score:  -1
The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:
  • Lowest score: -4 (low probability of substitution).
  • Highest score: 11 (high probability of substitution).
More information can be found on the following page

Involvement in disease:  Frontotemporal dementia (FTD) [MIM:600274]: A form of dementia characterized by pathologic finding of frontotemporal lobar degeneration, presenile dementia with behavioral changes, deterioration of cognitive capacities and loss of memory. In some cases, parkinsonian symptoms are prominent. Neuropathological changes include frontotemporal atrophy often associated with atrophy of the basal ganglia, substantia nigra, amygdala. In most cases, protein tau deposits are found in glial cells and/or neurons. {ECO:0000269|PubMed:10208578, ECO:0000269|PubMed:10214944, ECO:0000269|PubMed:10374757, ECO:0000269|PubMed:10489057, ECO:0000269|PubMed:10553987, ECO:0000269|PubMed:10802785, ECO:0000269|PubMed:11071507, ECO:0000269|PubMed:11117541, ECO:0000269|PubMed:11278002, ECO:0000269|PubMed:11585254, ECO:0000269|PubMed:11889249, ECO:0000269|PubMed:11906000, ECO:0000269|PubMed:11921059, ECO:0000269|PubMed:12473774, ECO:0000269|PubMed:12509859, ECO:0000269|PubMed:14517953, ECO:0000269|PubMed:15883319, ECO:0000269|PubMed:16240366, ECO:0000269|PubMed:26086902, ECO:0000269|PubMed:9629852, ECO:0000269|PubMed:9641683, ECO:0000269|PubMed:9736786, ECO:0000269|PubMed:9789048, ECO:0000269|PubMed:9973279}. Note=The disease is caused by mutations affecting the gene represented in this entry.
The name and a short description of the disease associated with the variant. For more information about the disease, the user can refer to OMIM, following the link provided after the disease acronym.

Variant description:  In FTD.
Any additional useful information about the variant.

Other resources:  
Links to websites of interest for the variant.



Sequence information

Variant position:  634
The position of the amino-acid change on the UniProtKB canonical protein sequence.

Protein sequence length:  758
The length of the canonical sequence.

Location on the sequence:   IKHVPGGGSVQIVYKPVDLS  K VTSKCGSLGNIHHKPGGGQV
The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.

Residue conservation: 
The multiple alignment of the region surrounding the variant against various orthologous sequences.

Human                         IKHVPGGGSVQIVYKPVDLSKVTSKCGSLGNIHHKPGGGQV

Gorilla                       IKHVPGGGSVQIVYKPVDLSKVTSKCGSLGNIHHKPGGGQV

Rhesus macaque                IKHVPGGGSVQIVYKPVDLSKVTSKCGSLGNIHHKPGGGQV

Chimpanzee                    IKHVPGGGSVQIVYKPVDLSKVTSKCGSLGNIHHKPGGGQV

Mouse                         IKHVPGGGSVQIVYKPVDLSKVTSKCGSLGNIHHKPGGGQV

Rat                           IKHVPGGGSVHIVYKPVDLSKVTSKCGSLGNIHHKPGGGQV

Bovine                        IKHVPGGGSVQIVYKPVDLSKVTSKCGSLGNIHHKPGGGQV

Goat                          IKHVPGGGSVQIVYKPVDLSKVTSKCGSLGNIHHKPGGGQV

Sequence annotation in neighborhood:  
The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:
  • Type: the type of sequence feature.
  • Positions: endpoints of the sequence feature.
  • Description: contains additional information about the feature.

TypePositionsDescription
Chain 2 – 758 Microtubule-associated protein tau
Repeat 623 – 653 Tau/MAP 3
Region 561 – 685 Microtubule-binding domain
Site 615 – 615 Not glycated
Site 628 – 628 Not glycated
Site 634 – 634 Not glycated
Site 638 – 638 Not glycated
Site 648 – 648 Not glycated
Modified residue 615 – 615 N6-acetyllysine; alternate
Modified residue 622 – 622 Phosphoserine; by PHK
Modified residue 628 – 628 N6,N6-dimethyllysine; alternate
Modified residue 628 – 628 N6-acetyllysine; alternate
Modified residue 634 – 634 N6-acetyllysine; alternate
Modified residue 638 – 638 N6-acetyllysine; alternate
Modified residue 641 – 641 Phosphoserine
Modified residue 648 – 648 N6-acetyllysine; alternate
Disulfide bond 608 – 639
Cross 615 – 615 Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin); alternate
Cross 628 – 628 Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin); in PHF-tau
Cross 634 – 634 Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin); alternate
Cross 638 – 638 Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin); alternate
Cross 648 – 648 Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin); alternate
Beta strand 634 – 640


Literature citations

A novel mutation (K317M) in the MAPT gene causes FTDP and motor neuron disease.
Zarranz J.J.; Ferrer I.; Lezcano E.; Forcadas M.I.; Eizaguirre B.; Atares B.; Puig B.; Gomez-Esteban J.C.; Fernandez-Maiztegui C.; Rouco I.; Perez-Concha T.; Fernandez M.; Rodriguez O.; Rodriguez-Martinez A.B.; de Pancorbo M.M.; Pastor P.; Perez-Tur J.;
Neurology 64:1578-1585(2005)
Cited for: VARIANT FTD MET-634;

Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.