UniProtKB/SwissProt variant VAR

Variant information

Variant position:

1007

The position of the amino-acid change on the UniProtKB canonical protein sequence.

Type of variant:

Disease [Disclaimer]

The variants are classified into three categories: Disease, Polymorphism and Unclassified.

Disease: Variants implicated in disease according to literature reports.
Polymorphism: Variants not reported to be implicated in disease.
Unclassified: Variants with uncertain implication in disease according to literature reports. Evidence against or in favor of a pathogenic role is limited and/or conflicting.

Residue change:

From Asparagine (N) to Serine (S) at position 1007 (N1007S, p.Asn1007Ser).

Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.

Physico-chemical properties:

Change from medium size and polar (N) to small size and polar (S)

The physico-chemical property of the reference and variant residues and the change implicated.

BLOSUM score:

1

The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:

Lowest score: -4 (low probability of substitution).
Highest score: 11 (high probability of substitution).

More information can be found on the following page

Involvement in disease:

Lujan-Fryns syndrome (LUJFRYS) [MIM:309520]: Clinically, Lujan-Fryns syndrome can be distinguished from Opitz-Kaveggia syndrome by tall stature, hypernasal voice, hyperextensible digits and high nasal root. {ECO:0000269|PubMed:17369503}. Note=The disease is caused by mutations affecting the gene represented in this entry.

The name and a short description of the disease associated with the variant. For more information about the disease, the user can refer to OMIM, following the link provided after the disease acronym.

Variant description:

In LUJFRYS.

Any additional useful information about the variant.

Other resources:

Links to websites of interest for the variant.

Variant rs80338759 [ dbSNP | Ensembl ]

Sequence information

Variant position:

1007

The position of the amino-acid change on the UniProtKB canonical protein sequence.

Protein sequence length:

2177

The length of the canonical sequence.

Location on the sequence:

NKFGELFSDFCSKVKNTIYC N VEPSESNMRWAPEFMIDTLE

The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.

Residue conservation:

The multiple alignment of the region surrounding the variant against various orthologous sequences.

Human                         NKFGE--------LFSDF-CSKVKNTIYCNVEPSE-SNMRWAPEFMIDTLE

Chimpanzee                    NKFGE--------LFSDF-CSKVKNTIYCNVEPSE-SNMRW

Mouse                         SKFGE--------LFSDF-CSKVKNTIYCNVEPSE-SNMRW

Zebrafish                     SKFGE--------IFSEF-CSKVKNSIYYNIDPSD-SNMLW

Caenorhabditis elegans        LQNEE--------FLAE---DSHFWRVFPNAQHVD-LDVGY

Drosophila                    EQSTE--------YYQQLQCIKRFKDIFNTPEQLDLPPQGY

Slime mold                    ENENNNIISKTIIIIKQQMVLSRLLCLFSIVYPISMNGKQL

Sequence annotation in neighborhood:

The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:

Type: the type of sequence feature.
Positions: endpoints of the sequence feature.
Description: contains additional information about the feature.

Type	Positions	Description
Chain	1 – 2177	Mediator of RNA polymerase II transcription subunit 12

Literature citations

The original Lujan syndrome family has a novel missense mutation (p.N1007S) in the MED12 gene.
Schwartz C.E.; Tarpey P.S.; Lubs H.A.; Verloes A.; May M.M.; Risheg H.; Friez M.J.; Futreal P.A.; Edkins S.; Teague J.; Briault S.; Skinner C.; Bauer-Carlin A.; Simensen R.J.; Joseph S.M.; Jones J.R.; Gecz J.; Stratton M.R.; Raymond F.L.; Stevenson R.E.;
J. Med. Genet. 44:472-477(2007)
Cited for: VARIANT LUJFRYS SER-1007;

UniProtKB/Swiss-Prot variant pages

UniProtKB/Swiss-Prot Q93074: Variant p.Asn1007Ser