Expasy logo

UniProtKB/Swiss-Prot variant pages

UniProtKB/Swiss-Prot P51149: Variant p.Lys157Asn

Ras-related protein Rab-7a
Gene: RAB7A
Feedback?
Variant information Variant position: help 157 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Type of variant: help LP/P [Disclaimer] The variants are classified into three categories: LP/P, LB/B and US.
  • LP/P: likely pathogenic or pathogenic.
  • LB/B: likely benign or benign.
  • US: uncertain significance
Residue change: help From Lysine (K) to Asparagine (N) at position 157 (K157N, p.Lys157Asn). Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.
Physico-chemical properties: help Change from large size and basic (K) to medium size and polar (N) The physico-chemical property of the reference and variant residues and the change implicated.
BLOSUM score: help 0 The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:
  • Lowest score: -4 (low probability of substitution).
  • Highest score: 11 (high probability of substitution).
More information can be found on the following page
Variant description: help In CMT2B; does not affect interaction with NTRK1; results in higher levels of NTRK1 and MAPK1/MAPK3 phosphorylation after NGF stimulation consistent with enhanced MAPK signaling; increases interaction with PRPH. Any additional useful information about the variant.
Other resources: help Links to websites of interest for the variant.


Sequence information Variant position: help 157 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Protein sequence length: help 207 The length of the canonical sequence.
Location on the sequence: help KRAQAWCYSKNNIPYFETSA K EAINVEQAFQTIARNALKQE The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.
Residue conservation: help The multiple alignment of the region surrounding the variant against various orthologous sequences. 
Human                         KRAQAWCYSKNNIPYFETSAKEAINVEQAFQTIARNALKQE

                              KRAQAWCYSKNNIPYFETSAKEAINVEQAFQTIARNALKQE

Mouse                         KRAQAWCYSKNNIPYFETSAKEAINVEQAFQTIARNALKQE

Rat                           KRAQAWCYSKNNIPYFETSAKEAINVEQAFQTIARNALKQE

Bovine                        KRAQAWCYSKNNIPYFETSAKEAINVEQAFQTIVRNALKQE

Rabbit                        KRAQAWSYSKNNIPYFETSAKEAINVEQAFQTIARNALKQE

Slime mold                    KRAASWCQSKGNIPYFETSAKEAINVEQAFQTIARNAIKLE
Sequence annotation in neighborhood: help The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:
  • Type: the type of sequence feature.
  • Positions: endpoints of the sequence feature.
  • Description: contains additional information about the feature.
TypePositionsDescription
Chain 2 – 207 Ras-related protein Rab-7a
Binding site 156 – 157
Turn 156 – 159



Literature citations
Charcot-Marie-Tooth type 2B disease-causing RAB7A mutant proteins show altered interaction with the neuronal intermediate filament peripherin.
Cogli L.; Progida C.; Thomas C.L.; Spencer-Dene B.; Donno C.; Schiavo G.; Bucci C.;
Acta Neuropathol. 125:257-272(2013)
Cited for: INTERACTION WITH PRPH; CHARACTERIZATION OF VARIANTS CMT2B PHE-129; ASN-157; THR-161 AND MET-162; MUTAGENESIS OF THR-22 AND GLN-67; Charcot-Marie-Tooth disease due to a de novo mutation of the RAB7 gene.
Meggouh F.; Bienfait H.M.E.; Weterman M.A.J.; de Visser M.; Baas F.;
Neurology 67:1476-1478(2006)
Cited for: VARIANT CMT2B ASN-157; Rab7 mutants associated with Charcot-Marie-Tooth disease exhibit enhanced NGF-stimulated signaling.
Basuray S.; Mukherjee S.; Romero E.; Wilson M.C.; Wandinger-Ness A.;
PLoS ONE 5:E15351-E15351(2010)
Cited for: CHARACTERIZATION OF VARIANTS CMT2B PHE-129; ASN-157; THR-161 AND MET-162;
Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.