Home  |  Contact

UniProtKB/Swiss-Prot Q9NSU2: Variant p.Tyr305Cys

Three-prime repair exonuclease 1
Gene: TREX1
Variant information

Variant position:  305
The position of the amino-acid change on the UniProtKB canonical protein sequence.

Type of variant:  Disease [Disclaimer]
The variants are classified into three categories: Disease, Polymorphism and Unclassified.
  • Disease: Variants implicated in disease according to literature reports.
  • Polymorphism: Variants not reported to be implicated in disease.
  • Unclassified: Variants with uncertain implication in disease according to literature reports. Evidence against or in favor of a pathogenic role is limited and/or conflicting.

Residue change:  From Tyrosine (Y) to Cysteine (C) at position 305 (Y305C, p.Tyr305Cys).
Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.

Physico-chemical properties:  Change from large size and aromatic (Y) to medium size and polar (C)
The physico-chemical property of the reference and variant residues and the change implicated.

BLOSUM score:  -2
The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:
  • Lowest score: -4 (low probability of substitution).
  • Highest score: 11 (high probability of substitution).
More information can be found on the following page

Variant description:  In SLE; decreases ubiquitination levels; decreases colocalization with UBQLN1; no effect on exonuclease activity.
Any additional useful information about the variant.

Other resources:  
Links to websites of interest for the variant.



Sequence information

Variant position:  305
The position of the amino-acid change on the UniProtKB canonical protein sequence.

Protein sequence length:  314
The length of the canonical sequence.

Location on the sequence:   EGLLAPLGLLAILTLAVATL  Y GLSLATPGE
The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.

Residue conservation: 
The multiple alignment of the region surrounding the variant against various orthologous sequences.

Human                         EGLLAPLGLLAILTLAVATLYGLSLATPGE

Mouse                         EGLLAPLSLLTLLTLAIATLYGLFLASPGQ

Bovine                        EGLLAPLGLLAFLTLAVAMLYGLSLAMPGQ

Sequence annotation in neighborhood:  
The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:
  • Type: the type of sequence feature.
  • Positions: endpoints of the sequence feature.
  • Description: contains additional information about the feature.

TypePositionsDescription
Chain 1 – 314 Three-prime repair exonuclease 1
Region 236 – 314 Necessary for endoplasmic reticulum localization
Region 243 – 314 Interaction with UBQLN1
Region 281 – 314 Necessary for cytoplasmic retention


Literature citations

The TREX1 C-terminal region controls cellular localization through ubiquitination.
Orebaugh C.D.; Fye J.M.; Harvey S.; Hollis T.; Wilkinson J.C.; Perrino F.W.;
J. Biol. Chem. 288:28881-28892(2013)
Cited for: INTERACTION WITH UBQLN1; UBIQUITINATION; CHARACTERIZATION OF VARIANTS AGS1 ALA-122; LYS-198; ASN-200 AND PRO-303; CHARACTERIZATION OF VARIANTS SLE LEU-290 AND CYS-305; MUTAGENESIS OF LYS-30; LYS-66; LYS-75; LYS-160; LYS-175; LYS-242; LYS-271 AND LYS-277;

Mutations in the gene encoding the 3'-5' DNA exonuclease TREX1 are associated with systemic lupus erythematosus.
Lee-Kirsch M.A.; Gong M.; Chowdhury D.; Senenko L.; Engel K.; Lee Y.A.; de Silva U.; Bailey S.L.; Witte T.; Vyse T.J.; Kere J.; Pfeiffer C.; Harvey S.; Wong A.; Koskenmies S.; Hummel O.; Rohde K.; Schmidt R.E.; Dominiczak A.F.; Gahr M.; Hollis T.; Perrino F.W.; Lieberman J.; Huebner N.;
Nat. Genet. 39:1065-1067(2007)
Cited for: VARIANTS SLE HIS-114; VAL-158; SER-227; SER-240; PRO-247; LEU-290; CYS-305 AND ALA-306; VARIANT GLY-266;

Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.