UniProtKB/SwissProt variant VAR

Variant information

Variant position:

182

The position of the amino-acid change on the UniProtKB canonical protein sequence.

Type of variant:

LP/P [Disclaimer]

The variants are classified into three categories: LP/P, LB/B and US.

LP/P: likely pathogenic or pathogenic.
LB/B: likely benign or benign.
US: uncertain significance

Residue change:

From Leucine (L) to Valine (V) at position 182 (L182V, p.Leu182Val).

Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.

Physico-chemical properties:

Similar physico-chemical property. Both residues are medium size and hydrophobic.

The physico-chemical property of the reference and variant residues and the change implicated.

BLOSUM score:

1

The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:

Lowest score: -4 (low probability of substitution).
Highest score: 11 (high probability of substitution).

More information can be found on the following page

Variant description:

In FRBRL.

Any additional useful information about the variant.

Other resources:

Links to websites of interest for the variant.

Variant rs137853597 [ dbSNP | Ensembl ]

Sequence information

Variant position:

182

The position of the amino-acid change on the UniProtKB canonical protein sequence.

Protein sequence length:

395

The length of the canonical sequence.

Location on the sequence:

DFGVFLGWNINNDTWVITEQ L KPLTVNLDFQRNNKTVFKAS

The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.

Residue conservation:

The multiple alignment of the region surrounding the variant against various orthologous sequences.

Human                         DFGVFLGWNINNDTWVITEQLKPLTVNLDFQRNNKTVFKAS

Chimpanzee                    DFGVFLGWNINNDTWVITEQLKPLTVNLDFQRNNKTVFKAS

Mouse                         DFGIFLGWNINNNTWVVTEELKPLTVNLDFQRNNKTVFKAT

Rat                           DFGIFLGWNINNNTWVVTEELKPLTVNLDFQRNNKTVFKAT

Bovine                        DFGVFLGWNINNDTWVITEELKPLTVNLDFQRNNKTLFKAT

Caenorhabditis elegans        DFGLFMGWDPVLHDWQISQKLRKMIINVNWLKDGKLLYKSN

Sequence annotation in neighborhood:

The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:

Type: the type of sequence feature.
Positions: endpoints of the sequence feature.
Description: contains additional information about the feature.

Type	Positions	Description
Chain	143 – 395	Acid ceramidase subunit beta
Site	162 – 162	Important for catalytic activity
Glycosylation	173 – 173	N-linked (GlcNAc...) asparagine
Glycosylation	195 – 195	N-linked (GlcNAc...) asparagine
Disulfide bond	31 – 340	Interchain (between alpha and beta subunits)
Mutagenesis	162 – 162	D -> N. Strongly decreased autocatalytic processing. Strongly decreased ceramidase activity.
Mutagenesis	173 – 173	N -> Q. Loss of ceramide catabolic process.
Mutagenesis	176 – 176	W -> Q. Moderately decreased autocatalytic processing, but loss of ceramidase activity, when associated with 169-Q--Q-171.
Mutagenesis	195 – 195	N -> Q. No effect on ceramide catabolic process.
Helix	177 – 182

Literature citations

Farber lipogranulomatosis: clinical and molecular genetic analysis reveals a novel mutation in an Indian family.
Devi A.R.R.; Gopikrishna M.; Ratheesh R.; Savithri G.; Swarnalata G.; Bashyam M.;
J. Hum. Genet. 51:811-814(2006)
Cited for: VARIANT FRBRL VAL-182;

UniProtKB/Swiss-Prot variant pages

UniProtKB/Swiss-Prot Q13510: Variant p.Leu182Val