Expasy logo

UniProtKB/Swiss-Prot variant pages

UniProtKB/Swiss-Prot Q9NRM7: Variant p.Leu1025Pro

Serine/threonine-protein kinase LATS2
Gene: LATS2
Feedback?
Variant information Variant position: help 1025
Type of variant: help LB/B
Residue change: help From Leucine (L) to Proline (P) at position 1025 (L1025P, p.Leu1025Pro).
Physico-chemical properties: help Similar physico-chemical property. Both residues are medium size and hydrophobic.
BLOSUM score: help -3
Other resources: help


Sequence information Variant position: help 1025
Protein sequence length: help 1088
Location on the sequence: help VDEESPWNDASEGSTKAWDT L TSPNNKHPEHAFYEFTFRRF
Residue conservation: help
Human                         VDEESPWNDASEGSTKAWDTLTSPNNKHPEHAFYEFTFRRF

Mouse                         VDEESPWHEASGESAKAWDTLASPSSKHPEHAFYEFTFRRF

Sequence annotation in neighborhood: help
TypePositionsDescription
Chain 1 – 1088 Serine/threonine-protein kinase LATS2
Domain 974 – 1052 AGC-kinase C-terminal
Modified residue 1041 – 1041 Phosphothreonine



Literature citations
Patterns of somatic mutation in human cancer genomes.
Greenman C.; Stephens P.; Smith R.; Dalgliesh G.L.; Hunter C.; Bignell G.; Davies H.; Teague J.; Butler A.; Stevens C.; Edkins S.; O'Meara S.; Vastrik I.; Schmidt E.E.; Avis T.; Barthorpe S.; Bhamra G.; Buck G.; Choudhury B.; Clements J.; Cole J.; Dicks E.; Forbes S.; Gray K.; Halliday K.; Harrison R.; Hills K.; Hinton J.; Jenkinson A.; Jones D.; Menzies A.; Mironenko T.; Perry J.; Raine K.; Richardson D.; Shepherd R.; Small A.; Tofts C.; Varian J.; Webb T.; West S.; Widaa S.; Yates A.; Cahill D.P.; Louis D.N.; Goldstraw P.; Nicholson A.G.; Brasseur F.; Looijenga L.; Weber B.L.; Chiew Y.-E.; DeFazio A.; Greaves M.F.; Green A.R.; Campbell P.; Birney E.; Easton D.F.; Chenevix-Trench G.; Tan M.-H.; Khoo S.K.; Teh B.T.; Yuen S.T.; Leung S.Y.; Wooster R.; Futreal P.A.; Stratton M.R.;
Nature 446:153-158(2007)
Cited for: VARIANTS [LARGE SCALE ANALYSIS] GLU-40; LEU-91; VAL-799; GLY-1014 AND PRO-1025;
Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.