Expasy logo

UniProtKB/Swiss-Prot variant pages

UniProtKB/Swiss-Prot Q96QP1: Variant p.Pro660Leu

Alpha-protein kinase 1
Gene: ALPK1
Feedback?
Variant information Variant position: help 660
Type of variant: help LB/B
Residue change: help From Proline (P) to Leucine (L) at position 660 (P660L, p.Pro660Leu).
Physico-chemical properties: help Similar physico-chemical property. Both residues are medium size and hydrophobic.
BLOSUM score: help -3
Other resources: help


Sequence information Variant position: help 660
Protein sequence length: help 1244
Location on the sequence: help SLHSQLHDLSLQEPNNDNLE P SQNQPQQQMPLTPFSPHNTP
Residue conservation: help
Human                         SLHSQLHDLSLQEPNNDNLEPSQNQPQQQMPLTPFSPHNTP

Mouse                         -LSSKLRGVSLQTTGDDNLESSPSQLHNHTSILPFNAKDTC

Sequence annotation in neighborhood: help
TypePositionsDescription
Chain 1 – 1244 Alpha-protein kinase 1
Region 650 – 675 Disordered
Compositional bias 652 – 675 Polar residues



Literature citations
Patterns of somatic mutation in human cancer genomes.
Greenman C.; Stephens P.; Smith R.; Dalgliesh G.L.; Hunter C.; Bignell G.; Davies H.; Teague J.; Butler A.; Stevens C.; Edkins S.; O'Meara S.; Vastrik I.; Schmidt E.E.; Avis T.; Barthorpe S.; Bhamra G.; Buck G.; Choudhury B.; Clements J.; Cole J.; Dicks E.; Forbes S.; Gray K.; Halliday K.; Harrison R.; Hills K.; Hinton J.; Jenkinson A.; Jones D.; Menzies A.; Mironenko T.; Perry J.; Raine K.; Richardson D.; Shepherd R.; Small A.; Tofts C.; Varian J.; Webb T.; West S.; Widaa S.; Yates A.; Cahill D.P.; Louis D.N.; Goldstraw P.; Nicholson A.G.; Brasseur F.; Looijenga L.; Weber B.L.; Chiew Y.-E.; DeFazio A.; Greaves M.F.; Green A.R.; Campbell P.; Birney E.; Easton D.F.; Chenevix-Trench G.; Tan M.-H.; Khoo S.K.; Teh B.T.; Yuen S.T.; Leung S.Y.; Wooster R.; Futreal P.A.; Stratton M.R.;
Nature 446:153-158(2007)
Cited for: VARIANTS [LARGE SCALE ANALYSIS] ARG-67; ASP-175; MET-292; MET-320; GLU-339; GLU-383; ASP-565; ARG-642; LEU-660; ASP-681; ILE-732; THR-861; SER-870; ILE-873; ASP-910; ASP-916; LEU-935; GLN-1084; PRO-1117 AND GLY-1160;
Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.