Expasy logo

UniProtKB/Swiss-Prot variant pages

Due to scheduled maintenance work, this service may suffer downtimes today between 07:00 p.m. until 10:00 p.m. CEST.
Apologies for the inconvenience.

UniProtKB/Swiss-Prot P42345: Variant p.Ser2215Tyr

Serine/threonine-protein kinase mTOR
Gene: MTOR
Feedback?
Variant information Variant position: help 2215 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Type of variant: help LP/P [Disclaimer] The variants are classified into three categories: LP/P, LB/B and US.
  • LP/P: likely pathogenic or pathogenic.
  • LB/B: likely benign or benign.
  • US: uncertain significance

Residue change: help From Serine (S) to Tyrosine (Y) at position 2215 (S2215Y, p.Ser2215Tyr). Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.
Physico-chemical properties: help Change from small size and polar (S) to large size and aromatic (Y) The physico-chemical property of the reference and variant residues and the change implicated.
BLOSUM score: help -2 The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:
  • Lowest score: -4 (low probability of substitution).
  • Highest score: 11 (high probability of substitution).
More information can be found on the following page

Variant description: help In FCORD2; also found in a colorectal adenocarcinoma sample; somatic mutation; increased TOR signaling. Any additional useful information about the variant.
Other resources: help Links to websites of interest for the variant.


Sequence information Variant position: help 2215 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Protein sequence length: help 2549 The length of the canonical sequence.
Location on the sequence: help DERVMQLFGLVNTLLANDPT S LRKNLSIQRYAVIPLSTNSG The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.
Residue conservation: help The multiple alignment of the region surrounding the variant against various orthologous sequences.
Human                         DERVMQLFGLVNTLLANDPTSLRKNLSIQRYAVIPLSTNSG

Mouse                         DERVMQLFGLVNTLLANDPTSLRKNLSIQRYAVIPLSTNSG

Rat                           DERVMQLFGLVNTLLANDPTSLRKNLSIQRYAVIPLSTNSG

Sequence annotation in neighborhood: help The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:
  • Type: the type of sequence feature.
  • Positions: endpoints of the sequence feature.
  • Description: contains additional information about the feature.
TypePositionsDescription
Chain 1 – 2549 Serine/threonine-protein kinase mTOR
Domain 2156 – 2469 PI3K/PI4K catalytic
Binding site 2225 – 2225
Helix 2213 – 2216



Literature citations
Somatic mutations in the MTOR gene cause focal cortical dysplasia type IIb.
Nakashima M.; Saitsu H.; Takei N.; Tohyama J.; Kato M.; Kitaura H.; Shiina M.; Shirozu H.; Masuda H.; Watanabe K.; Ohba C.; Tsurusaki Y.; Miyake N.; Zheng Y.; Sato T.; Takebayashi H.; Ogata K.; Kameyama S.; Kakita A.; Matsumoto N.;
Ann. Neurol. 78:375-386(2015)
Cited for: FUNCTION; INVOLVEMENT IN FCORD2; VARIANTS FCORD2 ASP-1459; PRO-1460; PHE-2215 AND TYR-2215; CHARACTERIZATION OF VARIANTS FCORD2 ASP-1459; PRO-1460; PHE-2215 AND TYR-2215;
Germline and somatic mutations in the MTOR gene in focal cortical dysplasia and epilepsy.
Moeller R.S.; Weckhuysen S.; Chipaux M.; Marsan E.; Taly V.; Bebin E.M.; Hiatt S.M.; Prokop J.W.; Bowling K.M.; Mei D.; Conti V.; de la Grange P.; Ferrand-Sorbets S.; Dorfmueller G.; Lambrecq V.; Larsen L.H.; Leguern E.; Guerrini R.; Rubboli G.; Cooper G.M.; Baulac S.;
Neurol. Genet. 2:E118-E118(2016)
Cited for: INVOLVEMENT IN FCORD2; VARIANTS GLU-1376 AND VAL-2501; VARIANTS FCORD2 SER-1459; PRO-1460; PHE-2215 AND TYR-2215; VARIANTS SKS ARG-1490; ILE-1595; THR-1832; CYS-1888 AND ILE-2327;
Patterns of somatic mutation in human cancer genomes.
Greenman C.; Stephens P.; Smith R.; Dalgliesh G.L.; Hunter C.; Bignell G.; Davies H.; Teague J.; Butler A.; Stevens C.; Edkins S.; O'Meara S.; Vastrik I.; Schmidt E.E.; Avis T.; Barthorpe S.; Bhamra G.; Buck G.; Choudhury B.; Clements J.; Cole J.; Dicks E.; Forbes S.; Gray K.; Halliday K.; Harrison R.; Hills K.; Hinton J.; Jenkinson A.; Jones D.; Menzies A.; Mironenko T.; Perry J.; Raine K.; Richardson D.; Shepherd R.; Small A.; Tofts C.; Varian J.; Webb T.; West S.; Widaa S.; Yates A.; Cahill D.P.; Louis D.N.; Goldstraw P.; Nicholson A.G.; Brasseur F.; Looijenga L.; Weber B.L.; Chiew Y.-E.; DeFazio A.; Greaves M.F.; Green A.R.; Campbell P.; Birney E.; Easton D.F.; Chenevix-Trench G.; Tan M.-H.; Khoo S.K.; Teh B.T.; Yuen S.T.; Leung S.Y.; Wooster R.; Futreal P.A.; Stratton M.R.;
Nature 446:153-158(2007)
Cited for: VARIANTS [LARGE SCALE ANALYSIS] SER-8; THR-135; VAL-1083; VAL-1134; PHE-1178; VAL-2011; TYR-2215 AND LEU-2476;
Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.