Expasy logo

UniProtKB/Swiss-Prot variant pages

UniProtKB/Swiss-Prot Q8IWU2: Variant p.Ser916Arg

Serine/threonine-protein kinase LMTK2
Gene: LMTK2
Feedback?
Variant information Variant position: help 916
Type of variant: help LB/B
Residue change: help From Serine (S) to Arginine (R) at position 916 (S916R, p.Ser916Arg).
Physico-chemical properties: help Change from small size and polar (S) to large size and basic (R)
BLOSUM score: help -1
Other resources: help


Sequence information Variant position: help 916
Protein sequence length: help 1503
Location on the sequence: help LTESDSVLADDILASRVSVG S SLPELGQELHNKPFSEDHHS
Residue conservation: help
Human                         LTESDSVLADDILASRVSVGSSLPELGQELHNKPFSEDHHS

Mouse                         LTNRHPILVNDITAQG-SVESCLPESRQDLQNEPFSEDPLS

Sequence annotation in neighborhood: help
TypePositionsDescription
Chain 1 – 1503 Serine/threonine-protein kinase LMTK2
Topological domain 64 – 1503 Cytoplasmic



Literature citations
Patterns of somatic mutation in human cancer genomes.
Greenman C.; Stephens P.; Smith R.; Dalgliesh G.L.; Hunter C.; Bignell G.; Davies H.; Teague J.; Butler A.; Stevens C.; Edkins S.; O'Meara S.; Vastrik I.; Schmidt E.E.; Avis T.; Barthorpe S.; Bhamra G.; Buck G.; Choudhury B.; Clements J.; Cole J.; Dicks E.; Forbes S.; Gray K.; Halliday K.; Harrison R.; Hills K.; Hinton J.; Jenkinson A.; Jones D.; Menzies A.; Mironenko T.; Perry J.; Raine K.; Richardson D.; Shepherd R.; Small A.; Tofts C.; Varian J.; Webb T.; West S.; Widaa S.; Yates A.; Cahill D.P.; Louis D.N.; Goldstraw P.; Nicholson A.G.; Brasseur F.; Looijenga L.; Weber B.L.; Chiew Y.-E.; DeFazio A.; Greaves M.F.; Green A.R.; Campbell P.; Birney E.; Easton D.F.; Chenevix-Trench G.; Tan M.-H.; Khoo S.K.; Teh B.T.; Yuen S.T.; Leung S.Y.; Wooster R.; Futreal P.A.; Stratton M.R.;
Nature 446:153-158(2007)
Cited for: VARIANTS [LARGE SCALE ANALYSIS] HIS-484; ILE-595; MET-624; THR-693; MET-780; PHE-849; THR-862; ARG-916; ASN-1061; ASN-1220; GLY-1341 AND ASN-1401;
Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.