UniProtKB/Swiss-Prot Q86YV5: Variant p.Arg404Gln

Inactive tyrosine-protein kinase PRAG1
Gene: PRAG1
Feedback?

Variant information Variant position:

404 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Type of variant:

LB/B The variants are classified into three categories: LP/P, LB/B and US.

LP/P: likely pathogenic or pathogenic.
LB/B: likely benign or benign.
US: uncertain significance

Residue change:

From Arginine (R) to Glutamine (Q) at position 404 (R404Q, p.Arg404Gln). Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.
Physico-chemical properties:

Change from large size and basic (R) to medium size and polar (Q) The physico-chemical property of the reference and variant residues and the change implicated.
BLOSUM score:

1 The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:

Lowest score: -4 (low probability of substitution).
Highest score: 11 (high probability of substitution).

More information can be found on the following page
Other resources:

Links to websites of interest for the variant.

Variant rs3896980 [ dbSNP | Ensembl ]

Sequence information Variant position:

404 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Protein sequence length:

1406 The length of the canonical sequence.
Location on the sequence:

GVTPSRCLGLTGEPQPPAHP R EATQPEPIYAESTKRKKAAP The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.
Residue conservation:

The multiple alignment of the region surrounding the variant against various orthologous sequences.

Human                         GVTPSRCLGLTGEPQPPAHPREATQPEPIYAESTKRKKAAP

Mouse                         FLTSGKCVGQAAELQPASLLRDPVQPEPIYAESAKRKKAAP

Rat                           LVNSGKYVGQAVDLQPPALPREAVQPEPIYAESAKRKKAAP

Sequence annotation in neighborhood:

The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:

Type: the type of sequence feature.
Positions: endpoints of the sequence feature.
Description: contains additional information about the feature.

Type	Positions	Description
Chain	1 – 1406	Inactive tyrosine-protein kinase PRAG1
Region	372 – 470	Disordered
Modified residue	413 – 413	Phosphotyrosine

Literature citations
The nucleotide sequence of a long cDNA clone isolated from human spleen.
Jikuya H.; Takano J.; Nomura N.; Kikuno R.; Nagase T.; Ohara O.;
Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 24-1406; VARIANTS GLN-404; LEU-569; CYS-578 AND THR-1113; Patterns of somatic mutation in human cancer genomes.
Greenman C.; Stephens P.; Smith R.; Dalgliesh G.L.; Hunter C.; Bignell G.; Davies H.; Teague J.; Butler A.; Stevens C.; Edkins S.; O'Meara S.; Vastrik I.; Schmidt E.E.; Avis T.; Barthorpe S.; Bhamra G.; Buck G.; Choudhury B.; Clements J.; Cole J.; Dicks E.; Forbes S.; Gray K.; Halliday K.; Harrison R.; Hills K.; Hinton J.; Jenkinson A.; Jones D.; Menzies A.; Mironenko T.; Perry J.; Raine K.; Richardson D.; Shepherd R.; Small A.; Tofts C.; Varian J.; Webb T.; West S.; Widaa S.; Yates A.; Cahill D.P.; Louis D.N.; Goldstraw P.; Nicholson A.G.; Brasseur F.; Looijenga L.; Weber B.L.; Chiew Y.-E.; DeFazio A.; Greaves M.F.; Green A.R.; Campbell P.; Birney E.; Easton D.F.; Chenevix-Trench G.; Tan M.-H.; Khoo S.K.; Teh B.T.; Yuen S.T.; Leung S.Y.; Wooster R.; Futreal P.A.; Stratton M.R.;
Nature 446:153-158(2007)
Cited for: VARIANTS [LARGE SCALE ANALYSIS] ILE-122; GLY-137; ILE-139; GLN-404; LEU-569; CYS-578; ALA-595; THR-662; LEU-814; ARG-851; LEU-1003; MET-1041; THR-1113 AND HIS-1315;

Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.