Expasy logo

UniProtKB/Swiss-Prot variant pages

UniProtKB/Swiss-Prot P54760: Variant p.Ala882Thr

Ephrin type-B receptor 4
Gene: EPHB4
Feedback?
Variant information Variant position: help 882
Type of variant: help LB/B
Residue change: help From Alanine (A) to Threonine (T) at position 882 (A882T, p.Ala882Thr).
Physico-chemical properties: help Change from small size and hydrophobic (A) to medium size and polar (T)
BLOSUM score: help 0
Other resources: help


Sequence information Variant position: help 882
Protein sequence length: help 987
Location on the sequence: help NARPRFPQVVSALDKMIRNP A SLKIVARENGGASHPLLDQR
Residue conservation: help
Human                         NARPRFPQVVSALDKMIRNPASLKIVARENGGASHPLLDQR

Mouse                         NARPRFPQVVSALDKMIRNPASLKIVARENGGASHPLLDQR

Sequence annotation in neighborhood: help
TypePositionsDescription
Chain 16 – 987 Ephrin type-B receptor 4
Topological domain 561 – 987 Cytoplasmic
Domain 615 – 899 Protein kinase
Alternative sequence 307 – 987 Missing. In isoform 3.
Alternative sequence 415 – 987 Missing. In isoform 4.
Alternative sequence 517 – 987 Missing. In isoform 2.
Helix 881 – 884



Literature citations
Patterns of somatic mutation in human cancer genomes.
Greenman C.; Stephens P.; Smith R.; Dalgliesh G.L.; Hunter C.; Bignell G.; Davies H.; Teague J.; Butler A.; Stevens C.; Edkins S.; O'Meara S.; Vastrik I.; Schmidt E.E.; Avis T.; Barthorpe S.; Bhamra G.; Buck G.; Choudhury B.; Clements J.; Cole J.; Dicks E.; Forbes S.; Gray K.; Halliday K.; Harrison R.; Hills K.; Hinton J.; Jenkinson A.; Jones D.; Menzies A.; Mironenko T.; Perry J.; Raine K.; Richardson D.; Shepherd R.; Small A.; Tofts C.; Varian J.; Webb T.; West S.; Widaa S.; Yates A.; Cahill D.P.; Louis D.N.; Goldstraw P.; Nicholson A.G.; Brasseur F.; Looijenga L.; Weber B.L.; Chiew Y.-E.; DeFazio A.; Greaves M.F.; Green A.R.; Campbell P.; Birney E.; Easton D.F.; Chenevix-Trench G.; Tan M.-H.; Khoo S.K.; Teh B.T.; Yuen S.T.; Leung S.Y.; Wooster R.; Futreal P.A.; Stratton M.R.;
Nature 446:153-158(2007)
Cited for: VARIANTS [LARGE SCALE ANALYSIS] LEU-67; ILE-113; LEU-346; VAL-371; GLU-576; HIS-678; THR-882; TRP-889 AND ASP-890;
Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.