UniProtKB/SwissProt variant VAR

Atrial natriuretic peptide receptor 1
Gene: NPR1
Feedback?

Variant information Variant position:

755
Type of variant:

LB/B
Residue change:

From Valine (V) to Methionine (M) at position 755 (V755M, p.Val755Met).
Physico-chemical properties:

Similar physico-chemical property. Both residues are medium size and hydrophobic.
BLOSUM score:

1
Other resources:

Variant rs55837780 [ dbSNP | Ensembl ]

Sequence information Variant position:

755
Protein sequence length:

1061
Location on the sequence:

RSGVFHVEGLDLSPKEIIER V TRGEQPPFRPSLALQSHLEE
Residue conservation:

Human                         RSGVFHVEGLDLSPKEIIERVTRGEQPPFRPSLALQSHLEE

Mouse                         RSGVFYVEGLDLSPKEIIERVTRGEQPPFRPSMDLQSHLEE

Rat                           RSGVFYVEGLDLSPKEIIERVTRGEQPPFRPSMDLQSHLEE

Sequence annotation in neighborhood:

Type	Positions	Description
Chain	33 – 1061	Atrial natriuretic peptide receptor 1
Topological domain	495 – 1061	Cytoplasmic
Domain	528 – 805	Protein kinase

Literature citations
Patterns of somatic mutation in human cancer genomes.
Greenman C.; Stephens P.; Smith R.; Dalgliesh G.L.; Hunter C.; Bignell G.; Davies H.; Teague J.; Butler A.; Stevens C.; Edkins S.; O'Meara S.; Vastrik I.; Schmidt E.E.; Avis T.; Barthorpe S.; Bhamra G.; Buck G.; Choudhury B.; Clements J.; Cole J.; Dicks E.; Forbes S.; Gray K.; Halliday K.; Harrison R.; Hills K.; Hinton J.; Jenkinson A.; Jones D.; Menzies A.; Mironenko T.; Perry J.; Raine K.; Richardson D.; Shepherd R.; Small A.; Tofts C.; Varian J.; Webb T.; West S.; Widaa S.; Yates A.; Cahill D.P.; Louis D.N.; Goldstraw P.; Nicholson A.G.; Brasseur F.; Looijenga L.; Weber B.L.; Chiew Y.-E.; DeFazio A.; Greaves M.F.; Green A.R.; Campbell P.; Birney E.; Easton D.F.; Chenevix-Trench G.; Tan M.-H.; Khoo S.K.; Teh B.T.; Yuen S.T.; Leung S.Y.; Wooster R.; Futreal P.A.; Stratton M.R.;
Nature 446:153-158(2007)
Cited for: VARIANTS [LARGE SCALE ANALYSIS] VAL-182; CYS-270; MET-755; GLN-939 AND LYS-967;

Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.

UniProtKB/Swiss-Prot variant pages

UniProtKB/Swiss-Prot P16066: Variant p.Val755Met