Expasy logo

UniProtKB/Swiss-Prot variant pages

UniProtKB/Swiss-Prot O60481: Variant p.Trp255Gly

Zinc finger protein ZIC 3
Gene: ZIC3
Feedback?
Variant information Variant position: help 255 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Type of variant: help LP/P [Disclaimer] The variants are classified into three categories: LP/P, LB/B and US.
  • LP/P: likely pathogenic or pathogenic.
  • LB/B: likely benign or benign.
  • US: uncertain significance
Residue change: help From Tryptophan (W) to Glycine (G) at position 255 (W255G, p.Trp255Gly). Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.
Physico-chemical properties: help Change from large size and aromatic (W) to glycine (G) The physico-chemical property of the reference and variant residues and the change implicated.
BLOSUM score: help -2 The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:
  • Lowest score: -4 (low probability of substitution).
  • Highest score: 11 (high probability of substitution).
More information can be found on the following page
Variant description: help In HTX1; decreases protein expression and transcriptional activity and increases its cytoplasmic localization. Any additional useful information about the variant.
Other resources: help Links to websites of interest for the variant.


Sequence information Variant position: help 255 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Protein sequence length: help 467 The length of the canonical sequence.
Location on the sequence: help GPGAFFRYMRQPIKQELSCK W IDEAQLSRPKKSCDRTFSTM The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.
Residue conservation: help The multiple alignment of the region surrounding the variant against various orthologous sequences. 
Human                         GPGAFFRYMRQPIKQELSCKWIDEAQLSRPKKSCDRTFSTM

Mouse                         GPGAFFRYMRQPIKQELSCKWIEEAQLSRPKKSCDRTFSTM

Xenopus laevis                GQGAFFRYMRQPIKQELSCKWLEESTMNHPQKTCDRTFSSM

Xenopus tropicalis            GPGAFFRYMRQPIKQELSCKWLEESPMNRPQKTCDRTFSSM
Sequence annotation in neighborhood: help The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:
  • Type: the type of sequence feature.
  • Positions: endpoints of the sequence feature.
  • Description: contains additional information about the feature.
TypePositionsDescription
Chain 1 – 467 Zinc finger protein ZIC 3
Zinc finger 251 – 286 C2H2-type 1; atypical
Cross 248 – 248 Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)
Mutagenesis 268 – 268 C -> S. Increases weakly its cytoplasmic localization.



Literature citations
Functional and structural basis of the nuclear localization signal in the ZIC3 zinc finger domain.
Hatayama M.; Tomizawa T.; Sakai-Kato K.; Bouvagnet P.; Kose S.; Imamoto N.; Yokoyama S.; Utsunomiya-Tate N.; Mikoshiba K.; Kigawa T.; Aruga J.;
Hum. Mol. Genet. 17:3459-3473(2008)
Cited for: STRUCTURE BY NMR OF 246-329 IN COMPLEX WITH ZINC IONS; INTERACTION WITH KPNA1 AND KPNA6; CHARACTERIZATION OF VARIANTS HTX1 SER-253; GLY-255 AND ARG-286; MUTAGENESIS OF CYS-268; HIS-281; ARG-304; LYS-307; LYS-310; LYS-312; LYS-314; ARG-320; LYS-326; LYS-337; ARG-341; LYS-346; LYS-349; ARG-350 AND LYS-356; Elucidation of penetrance variability of a ZIC3 mutation in a family with complex heart defects and functional analysis of ZIC3 mutations in the first zinc finger domain.
Chhin B.; Hatayama M.; Bozon D.; Ogawa M.; Schoen P.; Tohmonda T.; Sassolas F.; Aruga J.; Valard A.-G.; Chen S.-C.; Bouvagnet P.;
Hum. Mutat. 28:563-570(2007)
Cited for: VARIANT HTX1 GLY-255; CHARACTERIZATION OF VARIANT HTX1 GLY-255;
Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.