Expasy logo

UniProtKB/Swiss-Prot variant pages

UniProtKB/Swiss-Prot P81172: Variant p.Arg59Gly

Hepcidin
Gene: HAMP
Feedback?
Variant information Variant position: help 59 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Type of variant: help LP/P [Disclaimer] The variants are classified into three categories: LP/P, LB/B and US.
  • LP/P: likely pathogenic or pathogenic.
  • LB/B: likely benign or benign.
  • US: uncertain significance
Residue change: help From Arginine (R) to Glycine (G) at position 59 (R59G, p.Arg59Gly). Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.
Physico-chemical properties: help Change from large size and basic (R) to glycine (G) The physico-chemical property of the reference and variant residues and the change implicated.
BLOSUM score: help -2 The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:
  • Lowest score: -4 (low probability of substitution).
  • Highest score: 11 (high probability of substitution).
More information can be found on the following page
Variant description: help In HFE2B. Any additional useful information about the variant.
Other resources: help Links to websites of interest for the variant.


Sequence information Variant position: help 59 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Protein sequence length: help 84 The length of the canonical sequence.
Location on the sequence: help PQDRAGARASWMPMFQRRRR R DTHFPICIFCCGCCHRSKCG The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.
Residue conservation: help The multiple alignment of the region surrounding the variant against various orthologous sequences. 
Human                         PQDRAGARASWMPMFQ-RR-RRRDTHFPICIFCCGCCHRSKCG

                              AQDTAGAEAGLQPTLQLRRLRRRDTHFPICIFCCGCCKTPK

Mouse                         PLHGEESRADIAIPMQ-KR-RKRDTNFPICIFCCKCCNNSQ

Rat                           PWHGAESKTDDSALLMLKR-RKRDTNFPICLFCCKCCKNSS

Pig                           TQDTAGATAGLTPVAQ--R-LRRDTHFPICIFCCGCCRKAI


Literature citations
HAMP as a modifier gene that increases the phenotypic expression of the HFE pC282Y homozygous genotype.
Jacolot S.; Le Gac G.; Scotet V.; Quere I.; Mura C.; Ferec C.;
Blood 103:2835-2840(2004)
Cited for: VARIANTS HFE2B GLY-59 AND ASP-71;
Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.