Expasy logo

UniProtKB/Swiss-Prot variant pages

UniProtKB/Swiss-Prot Q8NFF2: Variant p.Val613Ile

Sodium/potassium/calcium exchanger 4
Gene: SLC24A4
Feedback?
Variant information Variant position: help 613
Type of variant: help LB/B
Residue change: help From Valine (V) to Isoleucine (I) at position 613 (V613I, p.Val613Ile).
Physico-chemical properties: help Similar physico-chemical property. Both residues are medium size and hydrophobic.
BLOSUM score: help 3
Polymorphism: help Genetic variants in SLC24A4 define the skin/hair/eye pigmentation variation locus 6 (SHEP6) [MIM:210750]. Hair, eye and skin pigmentation are among the most visible examples of human phenotypic variation, with a broad normal range that is subject to substantial geographic stratification. In the case of skin, individuals tend to have lighter pigmentation with increasing distance from the equator. By contrast, the majority of variation in human eye and hair color is found among individuals of European ancestry, with most other human populations fixed for brown eyes and black hair.
Other resources: help


Sequence information Variant position: help 613
Protein sequence length: help 622
Location on the sequence: help VLYAIFLCFSIMIEFNVFTF V NLPMCREDD
Residue conservation: help
Human                         VLYAIFLCFSIMIEFNVFTFVNLPMCREDD

Mouse                         VLYAVFLCFSIMIEFNVFTFVNLPMCREDD

Sequence annotation in neighborhood: help
TypePositionsDescription
Chain 39 – 622 Sodium/potassium/calcium exchanger 4
Topological domain 608 – 622 Extracellular



Literature citations
No reference for the current variant in UniProtKB/Swiss-Prot.
Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.