Home  |  Contact

UniProtKB/Swiss-Prot O15245: Variant p.Cys88Arg

Solute carrier family 22 member 1
Gene: SLC22A1
Variant information

Variant position:  88
The position of the amino-acid change on the UniProtKB canonical protein sequence.

Type of variant:  Polymorphism
The variants are classified into three categories: Disease, Polymorphism and Unclassified.
  • Disease: Variants implicated in disease according to literature reports.
  • Polymorphism: Variants not reported to be implicated in disease.
  • Unclassified: Variants with uncertain implication in disease according to literature reports. Evidence against or in favor of a pathogenic role is limited and/or conflicting.

Residue change:  From Cysteine (C) to Arginine (R) at position 88 (C88R, p.Cys88Arg).
Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.

Physico-chemical properties:  Change from medium size and polar (C) to large size and basic (R)
The physico-chemical property of the reference and variant residues and the change implicated.

BLOSUM score:  -3
The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:
  • Lowest score: -4 (low probability of substitution).
  • Highest score: 11 (high probability of substitution).
More information can be found on the following page

Other resources:  
Links to websites of interest for the variant.



Sequence information

Variant position:  88
The position of the amino-acid change on the UniProtKB canonical protein sequence.

Protein sequence length:  554
The length of the canonical sequence.

Location on the sequence:   EELNYTVPGLGPAGEAFLGQ  C RRYEVDWNQSALSCVDPLAS
The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.

Residue conservation: 
The multiple alignment of the region surrounding the variant against various orthologous sequences.

Human                         EELNYTVPGLGPAGEA-FLGQCRRYEVDWNQSALSCVDPLAS

Mouse                         EELNYTVPGLGSAGEASFLSQCMKYEVDWNQSTLDCVDPLS

Rat                           EELNYTVPGLGPSDEASFLSQCMRYEVDWNQSTLDCVDPLS

Pig                           EELNYTVPGLGPAGQA-FPRQCRRYEVDWNQSTLGCEDPLA

Bovine                        EELNYTVPGPGPE------SQCLRYEVDWNQSTLGCLDPLA

Rabbit                        EELNYTVPGLGATDGA-FVRQCMRYEVDWNQSSLGCVDPLA

Sequence annotation in neighborhood:  
The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:
  • Type: the type of sequence feature.
  • Positions: endpoints of the sequence feature.
  • Description: contains additional information about the feature.

TypePositionsDescription
Chain 1 – 554 Solute carrier family 22 member 1
Topological domain 43 – 149 Extracellular
Glycosylation 71 – 71 N-linked (GlcNAc...) asparagine


Literature citations

Identification of genetic variations of the human organic cation transporter hOCT1 and their functional consequences.
Kerb R.; Brinkmann U.; Chatskaia N.; Gorbunov D.; Gorboulev V.; Mornhinweg E.; Keil A.; Eichelbaum M.; Koepsell H.;
Pharmacogenetics 12:591-595(2002)
Cited for: VARIANTS CYS-61; ARG-88; PHE-160; SER-401 AND MET-420 DEL; CHARACTERIZATION OF VARIANTS CYS-61; ARG-88; PHE-160; SER-401 AND MET-420 DEL;

Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.