Home  |  Contact

UniProtKB/Swiss-Prot P12644: Variant p.Ser91Cys

Bone morphogenetic protein 4
Gene: BMP4
Chromosomal location: 14q22-q23
Variant information

Variant position:  91
The position of the amino-acid change on the UniProtKB canonical protein sequence.

Type of variant:  Disease [Disclaimer]
The variants are classified into three categories: Disease, Polymorphism and Unclassified.
  • Disease: Variants implicated in disease according to literature reports.
  • Polymorphism: Variants not reported to be implicated in disease.
  • Unclassified: Variants with uncertain implication in disease according to literature reports. Evidence against or in favor of a pathogenic role is limited and/or conflicting.

Residue change:  From Serine (S) to Cysteine (C) at position 91 (S91C, p.Ser91Cys).
Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.

Physico-chemical properties:  Change from small size and polar (S) to medium size and polar (C)
The physico-chemical property of the reference and variant residues and the change implicated.

BLOSUM score:  -1
The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:
  • Lowest score: -4 (low probability of substitution).
  • Highest score: 11 (high probability of substitution).
More information can be found on the following page

Involvement in disease:  Non-syndromic orofacial cleft 11 (OFC11) [MIM:600625]: A birth defect consisting of cleft lips with or without cleft palate. Cleft lips are associated with cleft palate in two-third of cases. A cleft lip can occur on one or both sides and range in severity from a simple notch in the upper lip to a complete opening in the lip extending into the floor of the nostril and involving the upper gum. {ECO:0000269|PubMed:19249007}. Note=The disease is caused by mutations affecting the gene represented in this entry.
The name and a short description of the disease associated with the variant. For more information about the disease, the user can refer to OMIM, following the link provided after the disease acronym.

Variant description:  In OFC11; also found in renal hypodysplasia patients.
Any additional useful information about the variant.

Other resources:  
Links to websites of interest for the variant.



Sequence information

Variant position:  91
The position of the amino-acid change on the UniProtKB canonical protein sequence.

Protein sequence length:  408
The length of the canonical sequence.

Location on the sequence:   PQPSKSAVIPDYMRDLYRLQ  S GEEEEEQIHSTGLEYPERPA
The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.

Residue conservation: 
The multiple alignment of the region surrounding the variant against various orthologous sequences.

Human                         PQPSKSAVIPDYMRDLYRLQSG-EEEEEQIHSTGLEYPERPA

Mouse                         PQPSKSAVIPDYMRDLYRLQSGEEEEEEQSQGTGLEYPERP

Rat                           PQPSKSAVIPDYMRDLYRLQSGEEEEEEQSQGTGLEYPERP

Bovine                        PQPSKSAVIPDYMRDLYRLQSGEEEEEEQIQGIGLEYPERP

Rabbit                        PQPSKSAVIPDYMRDLYRLQSGEEEEEEQMPSGGLEYPERP

Chicken                       PQPSKSAVIPSYMLDLYRLQSG-EEEERSLQEISLQYPERS

Xenopus laevis                PQPSKDVVVPAYMRDLYRLQSA--EEEDELHDISMEYPETP

Sequence annotation in neighborhood:  
The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:
  • Type: the type of sequence feature.
  • Positions: endpoints of the sequence feature.
  • Description: contains additional information about the feature.

TypePositionsDescription
Propeptide 20 – 292
Modified residue 91 – 91 Phosphoserine; by FAM20C


Literature citations

Evaluation of BMP4 and its specific inhibitor NOG as candidates in human neural tube defects (NTDs).
Felder B.; Stegmann K.; Schultealbert A.; Geller F.; Strehl E.; Ermert A.; Koch M.C.;
Eur. J. Hum. Genet. 10:753-756(2002)
Cited for: VARIANTS CYS-91; ALA-152; ALA-225; TRP-226 AND THR-367;

SIX2 and BMP4 mutations associate with anomalous kidney development.
Weber S.; Taylor J.C.; Winyard P.; Baker K.F.; Sullivan-Brown J.; Schild R.; Knueppel T.; Zurowska A.M.; Caldas-Alfonso A.; Litwin M.; Emre S.; Ghiggeri G.M.; Bakkaloglu A.; Mehls O.; Antignac C.; Schaefer F.; Burdine R.D.;
J. Am. Soc. Nephrol. 19:891-903(2008)
Cited for: VARIANTS CYS-91; SER-116 AND LYS-150;

Mutations in BMP4 are associated with subepithelial, microform, and overt cleft lip.
Suzuki S.; Marazita M.L.; Cooper M.E.; Miwa N.; Hing A.; Jugessur A.; Natsume N.; Shimozato K.; Ohbayashi N.; Suzuki Y.; Niimi T.; Minami K.; Yamamoto M.; Altannamar T.J.; Erkhembaatar T.; Furukawa H.; Daack-Hirsch S.; L'heureux J.; Brandon C.A.; Weinberg S.M.; Neiswanger K.; Deleyiannis F.W.; de Salamanca J.E.; Vieira A.R.; Lidral A.C.; Martin J.F.; Murray J.C.;
Am. J. Hum. Genet. 84:406-411(2009)
Cited for: VARIANTS OFC11 CYS-91; GLN-162; HIS-287 AND VAL-346; VARIANTS ALA-102; ALA-152 AND ALA-168;

Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.