Expasy logo

UniProtKB/Swiss-Prot variant pages

UniProtKB/Swiss-Prot Q96P20: Variant p.Ile174Thr

NACHT, LRR and PYD domains-containing protein 3
Gene: NLRP3
Feedback?
Variant information Variant position: help 174 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Type of variant: help LP/P [Disclaimer] The variants are classified into three categories: LP/P, LB/B and US.
  • LP/P: likely pathogenic or pathogenic.
  • LB/B: likely benign or benign.
  • US: uncertain significance
Residue change: help From Isoleucine (I) to Threonine (T) at position 174 (I174T, p.Ile174Thr). Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.
Physico-chemical properties: help Change from medium size and hydrophobic (I) to medium size and polar (T) The physico-chemical property of the reference and variant residues and the change implicated.
BLOSUM score: help -1 The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:
  • Lowest score: -4 (low probability of substitution).
  • Highest score: 11 (high probability of substitution).
More information can be found on the following page
Variant description: help In CINCA. Any additional useful information about the variant.
Other resources: help Links to websites of interest for the variant.


Sequence information Variant position: help 174 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Protein sequence length: help 1036 The length of the canonical sequence.
Location on the sequence: help RNARLGESVSLNKRYTRLRL I KEHRSQQEREQELLAIGKTK The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.
Residue conservation: help The multiple alignment of the region surrounding the variant against various orthologous sequences. 
Human                         RNARLGESVSLNKRYTRLRLIKEHRSQQEREQELLAIGKT--K

Rhesus macaque                RNARLGESVSLNKRYTRLRLIKEHRSQQEREHELLAIGKT-

Mouse                         RNARLGESVDLNSRYTQLQLVKEHPSKQEREHELLTIGRT-

Rat                           RNARLGESVDLNRRYTQLQLVKEHPSKQEREHELLTIGRT-

Bovine                        RNARLGESVNLNKRFTRLRLIKEHRSQQEREHELLAIGRTW
Sequence annotation in neighborhood: help The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:
  • Type: the type of sequence feature.
  • Positions: endpoints of the sequence feature.
  • Description: contains additional information about the feature.
TypePositionsDescription
Chain 1 – 1036 NACHT, LRR and PYD domains-containing protein 3
Domain 140 – 210 FISNA
Binding site 169 – 169
Modified residue 161 – 161 Phosphoserine
Modified residue 163 – 163 Phosphoserine
Modified residue 168 – 168 Phosphotyrosine; by BTK
Mutagenesis 155 – 155 N -> A. Impaired ability to activate the NLRP3 inflammasome.
Mutagenesis 157 – 157 R -> E. Impaired ability to activate the NLRP3 inflammasome.
Mutagenesis 166 – 166 K -> E. Impaired ability to activate the NLRP3 inflammasome.
Mutagenesis 168 – 168 Y -> F. Decreased phosphorylation by BTK; when associated with 136-F--F-143.
Mutagenesis 176 – 176 E -> R. Impaired ability to activate the NLRP3 inflammasome.
Beta strand 172 – 175



Literature citations
A novel CIAS1 mutation and plasma/cerebrospinal fluid cytokine profile in a German patient with neonatal-onset multisystem inflammatory disease responsive to methotrexate therapy.
Stojanov S.; Weiss M.; Lohse P.; Belohradsky B.H.;
Pediatrics 114:E124-E127(2004)
Cited for: VARIANT CINCA THR-174;
Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.