Expasy logo

UniProtKB/Swiss-Prot variant pages

UniProtKB/Swiss-Prot Q96P20: Variant p.Tyr572Cys

NACHT, LRR and PYD domains-containing protein 3
Gene: NLRP3
Feedback?
Variant information Variant position: help 572 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Type of variant: help LP/P [Disclaimer] The variants are classified into three categories: LP/P, LB/B and US.
  • LP/P: likely pathogenic or pathogenic.
  • LB/B: likely benign or benign.
  • US: uncertain significance
Residue change: help From Tyrosine (Y) to Cysteine (C) at position 572 (Y572C, p.Tyr572Cys). Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.
Physico-chemical properties: help Change from large size and aromatic (Y) to medium size and polar (C) The physico-chemical property of the reference and variant residues and the change implicated.
BLOSUM score: help -2 The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:
  • Lowest score: -4 (low probability of substitution).
  • Highest score: 11 (high probability of substitution).
More information can be found on the following page
Variant description: help In CINCA. Any additional useful information about the variant.
Other resources: help Links to websites of interest for the variant.


Sequence information Variant position: help 572 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Protein sequence length: help 1036 The length of the canonical sequence.
Location on the sequence: help KLPSRDVTVLLENYGKFEKG Y LIFVVRFLFGLVNQERTSYL The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.
Residue conservation: help The multiple alignment of the region surrounding the variant against various orthologous sequences. 
Human                         KLPSRDVTVLLENYGKFEKGYLIFVVRFLFGLVNQERTSYL

Rhesus macaque                KLPSRDVTVLLENYGKFEKGYLIFVVRFLFGLVNQERTCYL

Mouse                         DLLNRDVKVLLENYGKFEKGYLIFVVRFLFGLVNQERTSYL

Rat                           DLLNRDVKVLLENYGKFEKGYLIFVVRFLFGLVNQERTSYL

Bovine                        KLPNRDVKVLLENYGKFEKGYLIFVVRFLFGLINQERTSYL
Sequence annotation in neighborhood: help The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:
  • Type: the type of sequence feature.
  • Positions: endpoints of the sequence feature.
  • Description: contains additional information about the feature.
TypePositionsDescription
Chain 1 – 1036 NACHT, LRR and PYD domains-containing protein 3
Mutagenesis 578 – 578 R -> A. Abolished binding to small-inhibitor MCC950 and ability to activate the NLRP3 inflammasome following stimulation with nigericin.
Turn 571 – 573



Literature citations
De novo CIAS1 mutations, cytokine activation, and evidence for genetic heterogeneity in patients with neonatal-onset multisystem inflammatory disease (NOMID): a new member of the expanding family of pyrin-associated autoinflammatory diseases.
Aksentijevich I.; Nowak M.; Mallah M.; Chae J.J.; Watford W.T.; Hofmann S.R.; Stein L.; Russo R.; Goldsmith D.; Dent P.; Rosenberg H.F.; Austin F.; Remmers E.F.; Balow J.E. Jr.; Rosenzweig S.; Komarow H.; Shoham N.G.; Wood G.; Jones J.; Mangra N.; Carrero H.; Adams B.S.; Moore T.L.; Schikler K.; Hoffman H.; Lovell D.J.; Lipnick R.; Barron K.; O'Shea J.J.; Kastner D.L.; Goldbach-Mansky R.;
Arthritis Rheum. 46:3340-3348(2002)
Cited for: VARIANTS CINCA HIS-266; ASN-305; LEU-525 AND CYS-572; Molecular basis of the spectral expression of CIAS1 mutations associated with phagocytic cell-mediated autoinflammatory disorders CINCA/NOMID, MWS, and FCU.
Neven B.; Callebaut I.; Prieur A.-M.; Feldmann J.; Bodemer C.; Lepore L.; Derfalvi B.; Benjaponpitak S.; Vesely R.; Sauvain M.J.; Oertle S.; Allen R.; Morgan G.; Borkhardt A.; Hill C.; Gardner-Medwin J.; Fischer A.; de Saint Basile G.;
Blood 103:2809-2815(2004)
Cited for: VARIANTS CINCA LEU-262; PRO-262; ASN-305; GLY-305; SER-311; MET-350; ASP-356; PRO-407; ILE-438; CYS-572 AND PHE-634;
Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.