Home  |  Contact

UniProtKB/Swiss-Prot B0I1T2: Variant p.Met489Thr

Unconventional myosin-Ig
Gene: MYO1G
Variant information

Variant position:  489
The position of the amino-acid change on the UniProtKB canonical protein sequence.

Type of variant:  LB/B
The variants are classified into three categories: LP/P, LB/B and US.
  • LP/P: likely pathogenic or pathogenic.
  • LB/B: likely benign or benign.
  • US: uncertain significance

Residue change:  From Methionine (M) to Threonine (T) at position 489 (M489T, p.Met489Thr).
Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.

Physico-chemical properties:  Change from medium size and hydrophobic (M) to medium size and polar (T)
The physico-chemical property of the reference and variant residues and the change implicated.

BLOSUM score:  -1
The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:
  • Lowest score: -4 (low probability of substitution).
  • Highest score: 11 (high probability of substitution).
More information can be found on the following page

Other resources:  
Links to websites of interest for the variant.



Sequence information

Variant position:  489
The position of the amino-acid change on the UniProtKB canonical protein sequence.

Protein sequence length:  1018
The length of the canonical sequence.

Location on the sequence:   DEACSSAGTITDRIFLQTLD  M HHRHHLHYTSRQLCPTDKTM
The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.

Residue conservation: 
The multiple alignment of the region surrounding the variant against various orthologous sequences.

Human                         DEACSSAGTITDRIFLQTLDMHHRHHLHYTSRQLCPTDKTM

Mouse                         DEACSTAGPITDRIFLQTLDTHHRHHPHYSSRQLCPTDKTM

Chicken                       DEACLAVGTVTDALFLANMDARLGHHPHYSSRKLCPTDKTM

Sequence annotation in neighborhood:  
The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:
  • Type: the type of sequence feature.
  • Positions: endpoints of the sequence feature.
  • Description: contains additional information about the feature.

TypePositionsDescription
Chain 1 – 1018 Unconventional myosin-Ig
Domain 9 – 707 Myosin motor
Alternative sequence 231 – 1018 Missing. In isoform 2.


Literature citations

The nucleotide sequence of a long cDNA clone isolated from human spleen.
Jikuya H.; Takano J.; Nomura N.; Kikuno R.; Nagase T.; Ohara O.;
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2); NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 193-1018 (ISOFORM 3); VARIANT THR-489;

Multiplex amplification and cloning of 5'-ends of cDNA by ligase-free recombination: preparation of full-length cDNA clones encoding motor proteins.
Yamakawa H.; Kikuno R.F.; Nagase T.; Ohara O.;
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1); VARIANTS THR-489 AND ARG-861;

The HA-2 minor histocompatibility antigen is derived from a diallelic gene encoding a novel human class I myosin protein.
Pierce R.A.; Field E.D.; Mutis T.; Golovina T.N.; Von Kap-Herr C.; Wilke M.; Pool J.; Shabanowitz J.; Pettenati M.J.; Eisenlohr L.C.; Hunt D.F.; Goulmy E.; Engelhard V.H.;
J. Immunol. 167:3223-3230(2001)
Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 33-665 (ISOFORM 4); IDENTIFICATION AS THE MINOR HISTOCOMPATIBILITY ANTIGEN HA-2; VARIANTS HA-2M MET-49 AND THR-489; CHARACTERIZATION OF VARIANT HA-2M MET-49; TISSUE SPECIFICITY;

Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.