Home  |  Contact

UniProtKB/Swiss-Prot P04637: Variant p.Arg306Pro

Cellular tumor antigen p53
Gene: TP53
Variant information

Variant position:  306
The position of the amino-acid change on the UniProtKB canonical protein sequence.

Type of variant:  LP/P [Disclaimer]
The variants are classified into three categories: LP/P, LB/B and US.
  • LP/P: likely pathogenic or pathogenic.
  • LB/B: likely benign or benign.
  • US: uncertain significance

Residue change:  From Arginine (R) to Proline (P) at position 306 (R306P, p.Arg306Pro).
Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.

Physico-chemical properties:  Change from large size and basic (R) to medium size and hydrophobic (P)
The physico-chemical property of the reference and variant residues and the change implicated.

BLOSUM score:  -2
The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:
  • Lowest score: -4 (low probability of substitution).
  • Highest score: 11 (high probability of substitution).
More information can be found on the following page

Variant description:  In LFS; germline mutation and in a sporadic cancer; somatic mutation.
Any additional useful information about the variant.



Sequence information

Variant position:  306
The position of the amino-acid change on the UniProtKB canonical protein sequence.

Protein sequence length:  393
The length of the canonical sequence.

Location on the sequence:   EENLRKKGEPHHELPPGSTK  R ALPNNTSSSPQPKKKPLDGE
The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.

Residue conservation: 
The multiple alignment of the region surrounding the variant against various orthologous sequences.

Human                         EENLRKKGEPH--HELPPGSTKRALPNNTS-SSPQPK----KK----PLDGE

                              EENFHKKGEPC--PEPPPGSTKRALPPSTS-SSPPQK----

Rhesus macaque                EENFRKKGEPC--HQLPPGSTKRALPNNTS-SSPQPK----

Mouse                         EENFRKKEVLC--PELPPGSAKRALPTCTS-ASPPQK----

Rat                           EENFRKKEEHC--PELPPGSAKRALPTSTS-SSPQQK----

Pig                           EENFLKKGQSC--PEPPPGSTKRALPTSTS-SSPVQK----

Bovine                        EENLRKKGQSC--PEPPPRSTKRALPTNTS-SSPQPK----

Rabbit                        EENFRKKGEPC--PELPPGSSKRALPTTTTDSSPQTK----

Sheep                         EENFRKKGQSC--PEPPPGSTKRALPSSTS-SSPQQK----

Cat                           EENFRKKGEPC--PEPPPGSTKRALPPSTS-STPPQK----

Chicken                       EENFRKRGGAG-------GVAKRAMSPPTE-APEPPK----

Xenopus laevis                EDNYTKKRGLK-----PSGKRELAHPPSSE--PPLPK----

Zebrafish                     ESNFKKDQETKTMAKTTTGTKRSLVKESSS-ATLRPEGSKK

Sequence annotation in neighborhood:  
The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:
  • Type: the type of sequence feature.
  • Positions: endpoints of the sequence feature.
  • Description: contains additional information about the feature.

TypePositionsDescription
Chain 1 – 393 Cellular tumor antigen p53
Region 1 – 320 Interaction with CCAR2
Region 100 – 370 Interaction with HIPK1
Region 282 – 325 Disordered
Region 300 – 393 Interaction with CARM1
Motif 305 – 321 Bipartite nuclear localization signal
Compositional bias 305 – 319 Polar residues
Modified residue 305 – 305 N6-acetyllysine
Modified residue 315 – 315 Phosphoserine; by AURKA, CDK1 and CDK2
Modified residue 321 – 321 N6-acetyllysine
Cross 291 – 291 Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)
Cross 292 – 292 Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)
Mutagenesis 319 – 319 K -> A. Loss of nuclear localization; when associated with A-320 and A-321.
Mutagenesis 320 – 320 K -> A. Loss of nuclear localization; when associated with A-319 and A-321.
Mutagenesis 321 – 321 K -> A. Loss of nuclear localization; when associated with A-319 and A-320.


Literature citations

No reference for the current variant in UniProtKB/Swiss-Prot.

Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.