UniProtKB/Swiss-Prot Q95460: Variant p.His39Arg

Major histocompatibility complex class I-related gene protein
Gene: MR1
Feedback?

Variant information Variant position:

39 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Type of variant:

LB/B The variants are classified into three categories: LP/P, LB/B and US.

LP/P: likely pathogenic or pathogenic.
LB/B: likely benign or benign.
US: uncertain significance

Residue change:

From Histidine (H) to Arginine (R) at position 39 (H39R, p.His39Arg). Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.
Physico-chemical properties:

Change from medium size and polar (H) to large size and basic (R) The physico-chemical property of the reference and variant residues and the change implicated.
BLOSUM score:

0 The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:

Lowest score: -4 (low probability of substitution).
Highest score: 11 (high probability of substitution).

More information can be found on the following page
Polymorphism:

Several individuals from different ethnic background were analyzed for polymorphism. MR1 was identical in all individuals analyzed, except one. MR1 is not polymorphic. Additional information on the polymorphism described.
Other resources:

Links to websites of interest for the variant.

Variant rs2236410 [ dbSNP | Ensembl ]

Sequence information Variant position:

39 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Protein sequence length:

341 The length of the canonical sequence.
Location on the sequence:

HSDSRTHSLRYFRLGVSDPI H GVPEFISVGYVDSHPITTYD The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.
Residue conservation:

The multiple alignment of the region surrounding the variant against various orthologous sequences.

Human                         H--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------SDSRTHSLR-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------YFR-------------LGVSDPI------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------HGV-------------------------------------------------PEF-----------------------------------------ISVGYVDSH-----------------PITTYD

Chimpanzee                    H----------------------------------------

Mouse                         R----------------------------------------

Rat                           Q----------------------------------------

Bovine                        L----------------------------------------

Caenorhabditis elegans        QKLEEDDITRHVIFLGAFTEKTGEMIAQTKVIIDVIDSGDV

Sequence annotation in neighborhood:

The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:

Type: the type of sequence feature.
Positions: endpoints of the sequence feature.
Description: contains additional information about the feature.

Type	Positions	Description
Chain	23 – 341	Major histocompatibility complex class I-related gene protein
Topological domain	23 – 302	Extracellular
Region	23 – 201	Antigen-binding cleft
Region	23 – 109	Alpha-1
Binding site	31 – 31
Binding site	31 – 31
Binding site	46 – 46
Binding site	46 – 46
Beta strand	39 – 41

Literature citations
Unrelated expression patterns of MHC class Ia, Ib and TCRA molecules.
Han M.; Robinson M.A.;
Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 23-109; VARIANT ARG-39;

Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.