Expasy logo

UniProtKB/Swiss-Prot variant pages

UniProtKB/Swiss-Prot P15428: Variant p.Ala140Pro

15-hydroxyprostaglandin dehydrogenase [NAD(+)]
Gene: HPGD
Feedback?
Variant information Variant position: help 140 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Type of variant: help LP/P [Disclaimer] The variants are classified into three categories: LP/P, LB/B and US.
  • LP/P: likely pathogenic or pathogenic.
  • LB/B: likely benign or benign.
  • US: uncertain significance
Residue change: help From Alanine (A) to Proline (P) at position 140 (A140P, p.Ala140Pro). Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.
Physico-chemical properties: help Change from small size and hydrophobic (A) to medium size and hydrophobic (P) The physico-chemical property of the reference and variant residues and the change implicated.
BLOSUM score: help -1 The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:
  • Lowest score: -4 (low probability of substitution).
  • Highest score: 11 (high probability of substitution).
More information can be found on the following page
Variant description: help In COA; inactive. Any additional useful information about the variant.
Other resources: help Links to websites of interest for the variant.


Sequence information Variant position: help 140 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Protein sequence length: help 266 The length of the canonical sequence.
Location on the sequence: help DYMSKQNGGEGGIIINMSSL A GLMPVAQQPVYCASKHGIVG The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.
Residue conservation: help The multiple alignment of the region surrounding the variant against various orthologous sequences. 
Human                         DYMSKQNGGEGGIIINMSSLAGLMPVAQQPVYCASKHGIVG

Mouse                         DYMSKQNGGEGGIIINMSSLAGLMPVAQQPVYCASKHGIIG

Rat                           DYMSKQNGGEGGIIINISSIAGLMPVAQQPVYCASKHGIIG

Bovine                        DYMSKQNGGEGGININMSSLAGLMPVAQQPVYCASKHGIVG
Sequence annotation in neighborhood: help The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:
  • Type: the type of sequence feature.
  • Positions: endpoints of the sequence feature.
  • Description: contains additional information about the feature.
TypePositionsDescription
Chain 1 – 266 15-hydroxyprostaglandin dehydrogenase [NAD(+)]
Active site 151 – 151 Proton acceptor
Binding site 138 – 138
Binding site 148 – 148
Alternative sequence 73 – 140 Missing. In isoform 5.
Alternative sequence 140 – 143 AGLM -> AAHH. In isoform 4.
Mutagenesis 148 – 148 Q -> A. Loss of activity.
Mutagenesis 148 – 148 Q -> EHN. Reduced affinity for NAD and prostaglandin E2.
Mutagenesis 151 – 151 Y -> A. Loss of activity.
Mutagenesis 151 – 151 Y -> F. Loss 15-hydroxyprostaglandin dehydrogenase activity.
Mutagenesis 155 – 155 K -> Q. Loss 15-hydroxyprostaglandin dehydrogenase activity.
Helix 139 – 141



Literature citations
Mutations in 15-hydroxyprostaglandin dehydrogenase cause primary hypertrophic osteoarthropathy.
Uppal S.; Diggle C.P.; Carr I.M.; Fishwick C.W.G.; Ahmed M.; Ibrahim G.H.; Helliwell P.S.; Latos-Bielenska A.; Phillips S.E.V.; Markham A.F.; Bennett C.P.; Bonthron D.T.;
Nat. Genet. 40:789-793(2008)
Cited for: INVOLVEMENT IN PHOAR1; VARIANT COA PRO-140; CHARACTERIZATION OF VARIANT COA PRO-140;
Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.