Expasy logo

UniProtKB/Swiss-Prot variant pages

UniProtKB/Swiss-Prot P30532: Variant p.Asp398Asn

Neuronal acetylcholine receptor subunit alpha-5
Gene: CHRNA5
Feedback?
Variant information Variant position: help 398 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Type of variant: help LB/B The variants are classified into three categories: LP/P, LB/B and US.
  • LP/P: likely pathogenic or pathogenic.
  • LB/B: likely benign or benign.
  • US: uncertain significance

Residue change: help From Aspartate (D) to Asparagine (N) at position 398 (D398N, p.Asp398Asn). Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.
Physico-chemical properties: help Change from medium size and acidic (D) to medium size and polar (N) The physico-chemical property of the reference and variant residues and the change implicated.
BLOSUM score: help 1 The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:
  • Lowest score: -4 (low probability of substitution).
  • Highest score: 11 (high probability of substitution).
More information can be found on the following page

Polymorphism: help Genetic variations in CHRNA5 have been associated with susceptibility to smoking-related behavioral traits and lung cancer, contributing to the smoking quantitative trait locus 3 (SQTL3) [MIM:612052]. Additional information on the polymorphism described.
Variant description: help Risk factor for lung cancer; decreased calcium permeability and fast desensitization in (CHRNA4:CHRNB2)2:CHRNA5 but not in (CHRNA3:CHRNB4)2:CHRNA5 or (CHRNA3:CHRNB24)2:CHRNA5 AChR; no effect on activation by nicotine. Any additional useful information about the variant.
Other resources: help Links to websites of interest for the variant.


Sequence information Variant position: help 398 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Protein sequence length: help 468 The length of the canonical sequence.
Location on the sequence: help EETESGSGPKSSRNTLEAAL D SIRYITRHIMKENDVREVVE The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.
Residue conservation: help The multiple alignment of the region surrounding the variant against various orthologous sequences.
Human                         EETESGSGPKSSRNTLEAALDSIRYITRHIMKENDVREVVE

Chimpanzee                    EETESGSGPKSSRNTLEAALDSVRCITRHIMKENDVREVVE

Mouse                         EEAEKDGGPK-SRNTLEAALDCIRYITRHVVKENDVREVVE

Rat                           EEAESGAGPK-SRNTLEAALDCIRYITRHVVKENDVREVVE

Bovine                        EEARSSRGPRSSRNALEAALDSVRYITRHVMKETDVREVVE

Chicken                       EEKGNMSGSESSRNTLEAALDSIRYITRHVMKENEVREVVE

Sequence annotation in neighborhood: help The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:
  • Type: the type of sequence feature.
  • Positions: endpoints of the sequence feature.
  • Description: contains additional information about the feature.
TypePositionsDescription
Chain 23 – 468 Neuronal acetylcholine receptor subunit alpha-5
Topological domain 338 – 429 Cytoplasmic



Literature citations
Comparative structure of human neuronal alpha 2-alpha 7 and beta 2-beta 4 nicotinic acetylcholine receptor subunits and functional expression of the alpha 2, alpha 3, alpha 4, alpha 7, beta 2, and beta 4 subunits.
Elliott K.J.; Ellis S.B.; Berckhan K.J.; Urrutia A.; Chavez-Noriega L.E.; Johnson E.C.; Velicelebi G.; Harpold M.M.;
J. Mol. Neurosci. 7:217-228(1996)
Cited for: NUCLEOTIDE SEQUENCE [MRNA]; VARIANT ASN-398; Characterization of the genomic structure of human nicotinic acetylcholine receptor CHRNA5/A3/B4 gene cluster: identification of two novel introns in the 3' untranslated region of CHRNA3 and of a tail-to-tail overlap between CHRNA3 and CHRNA5.
Duga S.; Solda G.; Asselta R.; Bonati M.T.; Dalpra L.; Malcovati M.; Tenchini M.L.;
Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA]; VARIANT ASN-398; Acetylcholine receptor (AChR) alpha5 subunit variant associated with risk for nicotine dependence and lung cancer reduces (alpha4beta2)(2)alpha5 AChR function.
Kuryatov A.; Berrettini W.; Lindstrom J.;
Mol. Pharmacol. 79:119-125(2011)
Cited for: FUNCTION; CATALYTIC ACTIVITY; SUBUNIT; CHARACTERIZATION OF VARIANT ASN-398; INVOLVEMENT IN SQTL3 AND LUNG CANCER;
Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.