Expasy logo

UniProtKB/Swiss-Prot variant pages

UniProtKB/Swiss-Prot O95278: Variant p.Glu210Lys

Laforin
Gene: EPM2A
Feedback?
Variant information Variant position: help 210 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Type of variant: help LP/P [Disclaimer] The variants are classified into three categories: LP/P, LB/B and US.
  • LP/P: likely pathogenic or pathogenic.
  • LB/B: likely benign or benign.
  • US: uncertain significance

Residue change: help From Glutamate (E) to Lysine (K) at position 210 (E210K, p.Glu210Lys). Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.
Physico-chemical properties: help Change from medium size and acidic (E) to large size and basic (K) The physico-chemical property of the reference and variant residues and the change implicated.
BLOSUM score: help 1 The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:
  • Lowest score: -4 (low probability of substitution).
  • Highest score: 11 (high probability of substitution).
More information can be found on the following page

Variant description: help In MELF1. Any additional useful information about the variant.


Sequence information Variant position: help 210 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Protein sequence length: help 331 The length of the canonical sequence.
Location on the sequence: help MNFQTEWDIVQNSSGCNRYP E PMTPDTMIKLYREEGLAYIW The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.
Residue conservation: help The multiple alignment of the region surrounding the variant against various orthologous sequences.
Human                         MNFQTEWDIVQNSSGCNRYPEPMTPDTMIKLYREEGLAYIW

                              MNFQTEWDIVQNSSGCNRYPEPMTPDTMIKLYKEEGLVYIW

Mouse                         MNFQTEWDIIQNSSGCNRYPEPMTPDTMMKLYKEEGLSYIW

Rat                           MNFQTEWDIIQNSSGCNRYPEPMTPDTMMKLYKEEGLAYIW

Sequence annotation in neighborhood: help The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:
  • Type: the type of sequence feature.
  • Positions: endpoints of the sequence feature.
  • Description: contains additional information about the feature.
TypePositionsDescription
Chain 1 – 331 Laforin
Domain 156 – 323 Tyrosine-protein phosphatase
Binding site 197 – 197
Alternative sequence 1 – 243 Missing. In isoform 6.
Alternative sequence 160 – 293 Missing. In isoform 5.
Alternative sequence 200 – 331 Missing. In isoform 4.
Mutagenesis 194 – 194 T -> D. Does not affect interaction with NHLRC1, PPP1R3C or PRKAA2.
Mutagenesis 197 – 197 D -> A. Strongly decreased phosphatase activity. No effect on glycogen binding.
Mutagenesis 205 – 205 C -> S. No effect on homodimerization or carbohydrate binding. Decreased phosphatase activity.
Beta strand 208 – 210



Literature citations
Lafora disease in the Indian population: EPM2A and NHLRC1 gene mutations and their impact on subcellular localization of laforin and malin.
Singh S.; Satishchandra P.; Shankar S.K.; Ganesh S.;
Hum. Mutat. 29:E1-12(2008)
Cited for: VARIANTS MELF1 ASN-140; TYR-148; LYS-210 AND TRP-310; CHARACTERIZATION OF VARIANT MELF1 TRP-310; SUBCELLULAR LOCATION;
Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.