Expasy logo

UniProtKB/Swiss-Prot variant pages

UniProtKB/Swiss-Prot P58012: Variant p.Phe90Ser

Forkhead box protein L2
Gene: FOXL2
Feedback?
Variant information Variant position: help 90 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Type of variant: help LP/P [Disclaimer] The variants are classified into three categories: LP/P, LB/B and US.
  • LP/P: likely pathogenic or pathogenic.
  • LB/B: likely benign or benign.
  • US: uncertain significance
Residue change: help From Phenylalanine (F) to Serine (S) at position 90 (F90S, p.Phe90Ser). Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.
Physico-chemical properties: help Change from large size and aromatic (F) to small size and polar (S) The physico-chemical property of the reference and variant residues and the change implicated.
BLOSUM score: help -2 The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:
  • Lowest score: -4 (low probability of substitution).
  • Highest score: 11 (high probability of substitution).
More information can be found on the following page
Variant description: help In BPES; nuclear and cytoplasmic aggregation; impaired transactivation activity. Any additional useful information about the variant.


Sequence information Variant position: help 90 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Protein sequence length: help 376 The length of the canonical sequence.
Location on the sequence: help SAEKRLTLSGIYQYIIAKFP F YEKNKKGWQNSIRHNLSLNE The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.
Residue conservation: help The multiple alignment of the region surrounding the variant against various orthologous sequences. 
Human                         SAEKRLTLSGIYQYIIAKFPFYEKNKKGWQNSIRHNLSLNE

Mouse                         SAEKRLTLSGIYQYIIAKFPFYEKNKKGWQNSIRHNLSLNE

Pig                           SAEKRLTLSGIYQYIIAKFPFYEKNKKGWQNSIRHNLSLNE

Bovine                        SAEKRLTLSGIYQYIIAKFPFYEKNKKGWQNSIRHNLSLNE

Rabbit                        SAEKRLTLSGIYQYIIAKFPFYEKNKKGWQNSIRHNLSLNE

Goat                          SAEKRLTLSGIYQYIIAKFPFYEKNKKGWQNSIRHNLSLNE
Sequence annotation in neighborhood: help The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:
  • Type: the type of sequence feature.
  • Positions: endpoints of the sequence feature.
  • Description: contains additional information about the feature.
TypePositionsDescription
Chain 1 – 376 Forkhead box protein L2
DNA binding 54 – 148 Fork-head
Helix 89 – 92



Literature citations
Missense mutations in the forkhead domain of FOXL2 lead to subcellular mislocalization, protein aggregation and impaired transactivation.
Beysen D.; Moumne L.; Veitia R.; Peters H.; Leroy B.P.; De Paepe A.; De Baere E.;
Hum. Mol. Genet. 17:2030-2038(2008)
Cited for: CHARACTERIZATION OF VARIANTS BPES LEU-58; VAL-66; LYS-69; THR-80; ASN-84; SER-90; GLY-98; ARG-101; THR-102; CYS-103; ARG-104; PHE-106; PRO-106; LYS-109 AND PHE-217; Identification of 34 novel and 56 known FOXL2 mutations in patients with blepharophimosis syndrome.
Beysen D.; De Jaegere S.; Amor D.; Bouchard P.; Christin-Maitre S.; Fellous M.; Touraine P.; Grix A.W.; Hennekam R.; Meire F.; Oyen N.; Wilson L.C.; Barel D.; Clayton-Smith J.; de Ravel T.; Decock C.; Delbeke P.; Ensenauer R.; Ebinger F.; Gillessen-Kaesbach G.; Hendriks Y.; Kimonis V.; Laframboise R.; Laissue P.; Leppig K.; Leroy B.P.; Miller D.T.; Mowat D.; Neumann L.; Plomp A.; Van Regemorter N.; Wieczorek D.; Veitia R.A.; De Paepe A.; De Baere E.;
Hum. Mutat. 29:E205-E219(2008)
Cited for: VARIANTS BPES LEU-58; VAL-65; VAL-66; LYS-69; THR-80; ASN-84; SER-90; GLY-98; ARG-101; THR-102; CYS-103 AND PRO-106;
Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.