Home  |  Contact

UniProtKB/Swiss-Prot Q9HBL0: Variant p.Trp1197Arg

Tensin-1
Gene: TNS1
Variant information

Variant position:  1197
The position of the amino-acid change on the UniProtKB canonical protein sequence.

Type of variant:  Polymorphism
The variants are classified into three categories: Disease, Polymorphism and Unclassified.
  • Disease: Variants implicated in disease according to literature reports.
  • Polymorphism: Variants not reported to be implicated in disease.
  • Unclassified: Variants with uncertain implication in disease according to literature reports. Evidence against or in favor of a pathogenic role is limited and/or conflicting.

Residue change:  From Tryptophan (W) to Arginine (R) at position 1197 (W1197R, p.Trp1197Arg).
Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.

Physico-chemical properties:  Change from large size and aromatic (W) to large size and basic (R)
The physico-chemical property of the reference and variant residues and the change implicated.

BLOSUM score:  -3
The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:
  • Lowest score: -4 (low probability of substitution).
  • Highest score: 11 (high probability of substitution).
More information can be found on the following page

Variant description:  Common polymorphism.
Any additional useful information about the variant.

Other resources:  
Links to websites of interest for the variant.



Sequence information

Variant position:  1197
The position of the amino-acid change on the UniProtKB canonical protein sequence.

Protein sequence length:  1735
The length of the canonical sequence.

Location on the sequence:   SPQARHRTVGTNTPPSPGFG  W RAINPSMAAPSSPSLSHHQM
The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.

Residue conservation: 
The multiple alignment of the region surrounding the variant against various orthologous sequences.

Human                         SPQARHRTVGTNTPPSPGFGWRAINPSMAAPSSPSLSHHQM

Bovine                        SPQARHRTVGTNTPPSPGFGRRAVNPSLAAPSSPSLSHRQV

Sequence annotation in neighborhood:  
The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:
  • Type: the type of sequence feature.
  • Positions: endpoints of the sequence feature.
  • Description: contains additional information about the feature.

TypePositionsDescription
Chain 1 – 1735 Tensin-1
Modified residue 1177 – 1177 Phosphoserine
Modified residue 1189 – 1189 Phosphothreonine
Modified residue 1192 – 1192 Phosphoserine
Alternative sequence 386 – 1735 Missing. In isoform 2.


Literature citations

Molecular characterization of human tensin.
Chen H.; Ishii A.; Wong W.K.; Chen L.B.; Lo S.H.;
Biochem. J. 351:403-411(2000)
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1); TISSUE SPECIFICITY; VARIANTS ARG-1197 AND ILE-1604;

Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis.
Cantin G.T.; Yi W.; Lu B.; Park S.K.; Xu T.; Lee J.-D.; Yates J.R. III;
J. Proteome Res. 7:1346-1351(2008)
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-1192 AND SER-1314; VARIANT [LARGE SCALE ANALYSIS] ARG-1197; IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS];

Phosphoproteome of resting human platelets.
Zahedi R.P.; Lewandrowski U.; Wiesner J.; Wortelkamp S.; Moebius J.; Schuetz C.; Walter U.; Gambaryan S.; Sickmann A.;
J. Proteome Res. 7:526-534(2008)
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-1192 AND SER-1314; VARIANT [LARGE SCALE ANALYSIS] ARG-1197; IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS];

A quantitative atlas of mitotic phosphorylation.
Dephoure N.; Zhou C.; Villen J.; Beausoleil S.A.; Bakalarski C.E.; Elledge S.J.; Gygi S.P.;
Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008)
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-1177; SER-1192; THR-1266; SER-1269; SER-1381 AND SER-1446; VARIANT [LARGE SCALE ANALYSIS] ARG-1197; IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS];

Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
Olsen J.V.; Vermeulen M.; Santamaria A.; Kumar C.; Miller M.L.; Jensen L.J.; Gnad F.; Cox J.; Jensen T.S.; Nigg E.A.; Brunak S.; Mann M.;
Sci. Signal. 3:RA3-RA3(2010)
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-701; SER-1177; THR-1189; SER-1192; SER-1269; SER-1294 AND SER-1314; VARIANT [LARGE SCALE ANALYSIS] ARG-1197; IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS];

Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.