Home  |  Contact

UniProtKB/Swiss-Prot Q7LGC8: Variant p.Leu307Pro

Carbohydrate sulfotransferase 3
Gene: CHST3
Variant information

Variant position:  307
The position of the amino-acid change on the UniProtKB canonical protein sequence.

Type of variant:  Disease [Disclaimer]
The variants are classified into three categories: Disease, Polymorphism and Unclassified.
  • Disease: Variants implicated in disease according to literature reports.
  • Polymorphism: Variants not reported to be implicated in disease.
  • Unclassified: Variants with uncertain implication in disease according to literature reports. Evidence against or in favor of a pathogenic role is limited and/or conflicting.

Residue change:  From Leucine (L) to Proline (P) at position 307 (L307P, p.Leu307Pro).
Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.

Physico-chemical properties:  Similar physico-chemical property. Both residues are medium size and hydrophobic.
The physico-chemical property of the reference and variant residues and the change implicated.

BLOSUM score:  -3
The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:
  • Lowest score: -4 (low probability of substitution).
  • Highest score: 11 (high probability of substitution).
More information can be found on the following page

Involvement in disease:  Spondyloepiphyseal dysplasia with congenital joint dislocations (SEDCJD) [MIM:143095]: A bone dysplasia clinically characterized by dislocation of the knees and/or hips at birth, clubfoot, elbow joint dysplasia with subluxation and limited extension, short stature, and progressive kyphosis developing in late childhood. The disorder is usually evident at birth, with short stature and multiple joint dislocations or subluxations that dominate the neonatal clinical and radiographic picture. During childhood, the dislocations improve, both spontaneously and with surgical treatment, and features of spondyloepiphyseal dysplasia become apparent, leading to arthritis of the hips and spine with intervertebral disk degeneration, rigid kyphoscoliosis, and trunk shortening by late childhood. {ECO:0000269|PubMed:15215498, ECO:0000269|PubMed:18513679}. Note=The disease is caused by mutations affecting the gene represented in this entry.
The name and a short description of the disease associated with the variant. For more information about the disease, the user can refer to OMIM, following the link provided after the disease acronym.

Variant description:  In SEDCJD.
Any additional useful information about the variant.

Other resources:  
Links to websites of interest for the variant.



Sequence information

Variant position:  307
The position of the amino-acid change on the UniProtKB canonical protein sequence.

Protein sequence length:  479
The length of the canonical sequence.

Location on the sequence:   AEDPRLDLRVIQLVRDPRAV  L ASRMVAFAGKYKTWKKWLDD
The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.

Residue conservation: 
The multiple alignment of the region surrounding the variant against various orthologous sequences.

Human                         AEDPRLDLRVIQLVRDPRAVLASRMVAFAGKYKTWKKWLDD

Mouse                         VEDPRLDLRVIQLVRDPRAVLASRIVAFAGKYENWKKWLS-

Rat                           AEDPRLDLRVIQLVRDPRAVLASRMVAFAGKYESWKKWLS-

Chicken                       AEDPRLDLRIIQLVRDPRAVLVSRMVAFSGKYESWKKWAA-

Sequence annotation in neighborhood:  
The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:
  • Type: the type of sequence feature.
  • Positions: endpoints of the sequence feature.
  • Description: contains additional information about the feature.

TypePositionsDescription
Chain 1 – 479 Carbohydrate sulfotransferase 3
Topological domain 39 – 479 Lumenal
Nucleotide binding 301 – 309 PAPS


Literature citations

Congenital joint dislocations caused by carbohydrate sulfotransferase 3 deficiency in recessive Larsen syndrome and humero-spinal dysostosis.
Hermanns P.; Unger S.; Rossi A.; Perez-Aytes A.; Cortina H.; Bonafe L.; Boccone L.; Setzu V.; Dutoit M.; Sangiorgi L.; Pecora F.; Reicherter K.; Nishimura G.; Spranger J.; Zabel B.; Superti-Furga A.;
Am. J. Hum. Genet. 82:1368-1374(2008)
Cited for: VARIANTS SEDCJD TRP-222; PRO-259; PRO-307 AND LYS-372; VARIANT GLN-357; CHARACTERIZATION OF VARIANTS SEDCJD TRP-222 AND PRO-259;

Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.