Expasy logo

UniProtKB/Swiss-Prot variant pages

UniProtKB/Swiss-Prot O60880: Variant p.Leu31Pro

SH2 domain-containing protein 1A
Gene: SH2D1A
Feedback?
Variant information Variant position: help 31 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Type of variant: help LP/P [Disclaimer] The variants are classified into three categories: LP/P, LB/B and US.
  • LP/P: likely pathogenic or pathogenic.
  • LB/B: likely benign or benign.
  • US: uncertain significance
Residue change: help From Leucine (L) to Proline (P) at position 31 (L31P, p.Leu31Pro). Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.
Physico-chemical properties: help Similar physico-chemical property. Both residues are medium size and hydrophobic. The physico-chemical property of the reference and variant residues and the change implicated.
BLOSUM score: help -3 The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:
  • Lowest score: -4 (low probability of substitution).
  • Highest score: 11 (high probability of substitution).
More information can be found on the following page
Variant description: help In XLP1; reduced protein stability and reduced affinity for SLAMF1 and FYN. Any additional useful information about the variant.


Sequence information Variant position: help 31 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Protein sequence length: help 128 The length of the canonical sequence.
Location on the sequence: help ISRETGEKLLLATGLDGSYL L RDSESVPGVYCLCVLYHGYI The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.
Residue conservation: help The multiple alignment of the region surrounding the variant against various orthologous sequences. 
Human                         ISRETGEKLLLATGLDGSYLLRDSESVPGVYCLCVLYHGYI

Rhesus macaque                ISRETGEKLLLATGLDGSYLLRDSESVPGVYCLCVLYHGYI

Mouse                         ISRETGEKLLLATGLDGSYLLRDSESVPGVYCLCVLYQGYI

Rat                           ISREMGEKLLLATGLDGSYLLRDSESVPGVYCLCVLYQGYI

Pig                           ISRETGEKLLLATGLDGSYLLRDSESVPGVYCLCVLYQGYI

Bovine                        ISRETGEKLLLATGLDGSYLLRDSESVPGVYCLCVLYQGYI
Sequence annotation in neighborhood: help The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:
  • Type: the type of sequence feature.
  • Positions: endpoints of the sequence feature.
  • Description: contains additional information about the feature.
TypePositionsDescription
Chain 1 – 128 SH2 domain-containing protein 1A
Domain 6 – 104 SH2
Mutagenesis 32 – 32 R -> Q. Strongly reduced affinity for SLAMF1.
Beta strand 28 – 33



Literature citations
Correlation of mutations of the SH2D1A gene and Epstein-Barr virus infection with clinical phenotype and outcome in X-linked lymphoproliferative disease.
Sumegi J.; Huang D.; Lanyi A.; Davis J.D.; Seemayer T.A.; Maeda A.; Klein G.; Seri M.; Wakiguchi H.; Purtilo D.T.; Gross T.G.;
Blood 96:3118-3125(2000)
Cited for: VARIANTS XLP1 CYS-7; ARG-28; PRO-31; TRP-42; ILE-53; CYS-54; SER-87; PRO-99 AND GLY-102; Disease-causing SAP mutants are defective in ligand binding and protein folding.
Li C.; Iosef C.; Jia C.Y.H.; Gkourasas T.; Han V.K.M.; Li S.-C.;
Biochemistry 42:14885-14892(2003)
Cited for: CHARACTERIZATION OF VARIANTS XLP1 PRO-31; CYS-54; LEU-55 AND SER-87;
Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.