UniProtKB/Swiss-Prot Q14574: Variant p.Ala28Asp

Desmocollin-3
Gene: DSC3
Feedback?

Variant information Variant position:

28 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Type of variant:

LB/B The variants are classified into three categories: LP/P, LB/B and US.

LP/P: likely pathogenic or pathogenic.
LB/B: likely benign or benign.
US: uncertain significance

Residue change:

From Alanine (A) to Aspartate (D) at position 28 (A28D, p.Ala28Asp). Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.
Physico-chemical properties:

Change from small size and hydrophobic (A) to medium size and acidic (D) The physico-chemical property of the reference and variant residues and the change implicated.
BLOSUM score:

-2 The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:

Lowest score: -4 (low probability of substitution).
Highest score: 11 (high probability of substitution).

More information can be found on the following page
Other resources:

Links to websites of interest for the variant.

Variant rs2852003 [ dbSNP | Ensembl ]

Sequence information Variant position:

28 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Protein sequence length:

896 The length of the canonical sequence.
Location on the sequence:

RSVRGAVCLHLLLTLVIFSR A GEACKKVILNVPSKLEADKI The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.
Residue conservation:

The multiple alignment of the region surrounding the variant against various orthologous sequences.

Human                         RSVRGAVCLHLLLTLVIFSRAGEACKKVILNVPSKLEADKI

Mouse                         SPQCRALCTKLLLTLWVFSFVGEACKKVTFHVPSTLEADKI

Bovine                        AP-CAELCRQLLLTLVVFSFACEACKKEIFNIPSKLEADKM

Baker's yeast                 LPTHNG------------SQGGE------------------

Fission yeast                 KWE------------IVIRFA--------------------

Sequence annotation in neighborhood:

The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:

Type: the type of sequence feature.
Positions: endpoints of the sequence feature.
Description: contains additional information about the feature.

Type	Positions	Description
Propeptide	28 – 135

Literature citations
The desmocollins of human foreskin epidermis: identification and chromosomal assignment of a third gene and expression patterns of the three isoforms.
King I.A.; Sullivan K.H.; Bennett R. Jr.; Buxton R.S.;
J. Invest. Dermatol. 105:314-321(1995)
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 3A); VARIANT ASP-28; Genomic organization and amplification of the human desmosomal cadherin genes DSC1 and DSC3, encoding desmocollin types 1 and 3.
Whittock N.V.; Hunt D.M.; Rickman L.; Malhi S.; Vogazianou A.P.; Dawson L.F.; Eady R.A.J.; Buxton R.S.; McGrath J.A.;
Biochem. Biophys. Res. Commun. 276:454-460(2000)
Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] (ISOFORMS 3A AND 3B); VARIANT ASP-28;

Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.