UniProtKB/Swiss-Prot P24666: Variant p.Ser137Phe

Low molecular weight phosphotyrosine protein phosphatase
Gene: ACP1
Feedback?

Variant information Variant position:

137 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Type of variant:

LB/B The variants are classified into three categories: LP/P, LB/B and US.

LP/P: likely pathogenic or pathogenic.
LB/B: likely benign or benign.
US: uncertain significance

Residue change:

From Serine (S) to Phenylalanine (F) at position 137 (S137F, p.Ser137Phe). Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.
Physico-chemical properties:

Change from small size and polar (S) to large size and aromatic (F) The physico-chemical property of the reference and variant residues and the change implicated.
BLOSUM score:

-2 The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:

Lowest score: -4 (low probability of substitution).
Highest score: 11 (high probability of substitution).

More information can be found on the following page
Polymorphism:

ACP1 is genetically polymorphic. Three common alleles are known in Caucasians: ACP1*A, ACP1*B and ACP1*C. They give rise to six different phenotypes. Each allele appears to encode two electrophoretically different isozymes, F and S, which are produced in allele-specific ratios (PubMed:1939112). The sequence shown is that of allele ACP1*B and allele ACP1*C. Additional information on the polymorphism described.
Other resources:

Links to websites of interest for the variant.

Variant rs35569198 [ dbSNP | Ensembl ]

Sequence information Variant position:

137 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Protein sequence length:

158 The length of the canonical sequence.
Location on the sequence:

LGSYDPQKQLIIEDPYYGND S DFETVYQQCVRCCRAFLEKA The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.
Residue conservation:

The multiple alignment of the region surrounding the variant against various orthologous sequences.

Human                         LGSYDPQKQLIIED-PYYGN---------------DSDFETVYQQCVRCCRA----------------------------------FLEKA

Mouse                         LGSYDPQKQLIIED-PYYGN---------------DSDFEV

Rat                           LGSYDPQKQLIIED-PYYGN---------------DSDFEV

Pig                           LGSYDPQKQLIIED-PYYGN---------------DSDFEA

Bovine                        LGSYDPQKQLIIED-PYYGN---------------DADFET

Chicken                       LGAYDPQKQLIIED-PYYGN---------------EKDFET

Slime mold                    LGEYHTHKKINVED-PYYGD---------------MSNFNI

Baker's yeast                 IGIIDDQNNLTAEHVPFMENTFHRSWYVPQGARVYTEKFQC

Sequence annotation in neighborhood:

The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:

Type: the type of sequence feature.
Positions: endpoints of the sequence feature.
Description: contains additional information about the feature.

Type	Positions	Description
Chain	2 – 158	Low molecular weight phosphotyrosine protein phosphatase
Active site	130 – 130	Proton donor
Modified residue	132 – 132	Phosphotyrosine
Modified residue	133 – 133	Phosphotyrosine
Alternative sequence	113 – 158	Missing. In isoform 4.
Mutagenesis	132 – 132	Y -> F. Reduced phosphorylation and activity.
Mutagenesis	133 – 133	Y -> F. Reduced phosphorylation. No effect on activity.
Helix	136 – 155

Literature citations
No reference for the current variant in UniProtKB/Swiss-Prot.

Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.