UniProtKB/Swiss-Prot P11388: Variant p.Gly1386Asp

DNA topoisomerase 2-alpha
Gene: TOP2A
Feedback?

Variant information Variant position:

1386 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Type of variant:

LB/B The variants are classified into three categories: LP/P, LB/B and US.

LP/P: likely pathogenic or pathogenic.
LB/B: likely benign or benign.
US: uncertain significance

Residue change:

From Glycine (G) to Aspartate (D) at position 1386 (G1386D, p.Gly1386Asp). Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.
Physico-chemical properties:

Change from glycine (G) to medium size and acidic (D) The physico-chemical property of the reference and variant residues and the change implicated.
BLOSUM score:

-1 The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:

Lowest score: -4 (low probability of substitution).
Highest score: 11 (high probability of substitution).

More information can be found on the following page
Other resources:

Links to websites of interest for the variant.

Variant rs34300454 [ dbSNP | Ensembl ]

Sequence information Variant position:

1386 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Protein sequence length:

1531 The length of the canonical sequence.
Location on the sequence:

NKELKPQKSVVSDLEADDVK G SVPLSSSPPATHFPDETEIT The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.
Residue conservation:

The multiple alignment of the region surrounding the variant against various orthologous sequences.

Human                         NKELKPQKSVVS--DLEADDV-KGSVPLSSSPPATHFPDETEIT

Mouse                         KKALKTQGSSMSVVDLESDV--KDSVPASPGVPAADFPAET

Rat                           KKALKPQKSSTS-VDLESDG--KDSVPASPGASAADVPAET

Pig                           NKEPKPQKSTPSVSDFDADDA-KDNVPPSPSSPVADFPAVT

Chicken                       KGKAPKEKPLPDAVPVRVQNVAAESASQDPAAPPVSVP---

Sequence annotation in neighborhood:

The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:

Type: the type of sequence feature.
Positions: endpoints of the sequence feature.
Description: contains additional information about the feature.

Type	Positions	Description
Chain	1 – 1531	DNA topoisomerase 2-alpha
Region	1184 – 1531	Disordered
Modified residue	1374 – 1374	Phosphoserine
Modified residue	1377 – 1377	Phosphoserine
Modified residue	1387 – 1387	Phosphoserine
Modified residue	1391 – 1391	Phosphoserine
Modified residue	1392 – 1392	Phosphoserine
Modified residue	1393 – 1393	Phosphoserine
Cross	1367 – 1367	Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)
Cross	1373 – 1373	Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)
Cross	1385 – 1385	Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)

Literature citations
No reference for the current variant in UniProtKB/Swiss-Prot.

Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.