Expasy logo

UniProtKB/Swiss-Prot variant pages

UniProtKB/Swiss-Prot Q9NYV8: Variant p.Thr86Ala

Taste receptor type 2 member 14
Gene: TAS2R14
Feedback?
Variant information Variant position: help 86 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Type of variant: help LB/B The variants are classified into three categories: LP/P, LB/B and US.
  • LP/P: likely pathogenic or pathogenic.
  • LB/B: likely benign or benign.
  • US: uncertain significance

Residue change: help From Threonine (T) to Alanine (A) at position 86 (T86A, p.Thr86Ala). Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.
Physico-chemical properties: help Change from medium size and polar (T) to small size and hydrophobic (A) The physico-chemical property of the reference and variant residues and the change implicated.
BLOSUM score: help 0 The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:
  • Lowest score: -4 (low probability of substitution).
  • Highest score: 11 (high probability of substitution).
More information can be found on the following page

Other resources: help Links to websites of interest for the variant.


Sequence information Variant position: help 86 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Protein sequence length: help 317 The length of the canonical sequence.
Location on the sequence: help WCVSVFFPALFATEKMFRML T NIWTVINHFSVWLATGLGTF The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.
Residue conservation: help The multiple alignment of the region surrounding the variant against various orthologous sequences.
Human                         WCVSVFFPALFATEKMFRMLTNIWTVINHFSVWLATGLGTF

Gorilla                       WCVSVFLPALFATEKMFRMLTNIWTVINHFSVWLATGLGTF

Rhesus macaque                WCVSVFFPALFATEKLLRMLTNIWTVTNHFSVWLATILGTF

Chimpanzee                    WCVSVFFPALFATEKMFRMLTNIWTVINHFSVWLATGLGTF

Sequence annotation in neighborhood: help The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:
  • Type: the type of sequence feature.
  • Positions: endpoints of the sequence feature.
  • Description: contains additional information about the feature.
TypePositionsDescription
Chain 1 – 317 Taste receptor type 2 member 14
Topological domain 77 – 87 Extracellular
Binding site 86 – 86
Binding site 89 – 89
Mutagenesis 82 – 82 F -> A. Impairs calcium mobilization induced by aristolochic acid and flufenamic acid.
Mutagenesis 89 – 89 W -> A. Abolishes basal activities of TAS2R14-GNAI1 and TAS2R14-GNAT3. Abolishes activation of TAS2R14-GNAT3 by flufenamic acid derivative cmpd28.1. Impairs calcium mobilization induced by aristolochic acid and flufenamic acid. Impairs calcium mobilization; when associated with A-65. Abolishes calcium mobilization; when associated with A-180. Abolishes calcium mobilization; when associated with A-65 and A-180.
Mutagenesis 104 – 104 G -> A. Impairs calcium mobilization induced by aristolochic acid, flufenamic acid and flufenamic acid derivative cmpd28.1.



Literature citations
No reference for the current variant in UniProtKB/Swiss-Prot.
Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.