Expasy logo

UniProtKB/Swiss-Prot variant pages

UniProtKB/Swiss-Prot Q99972: Variant p.Gln48His

Myocilin
Gene: MYOC
Feedback?
Variant information Variant position: help 48 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Type of variant: help LP/P [Disclaimer] The variants are classified into three categories: LP/P, LB/B and US.
  • LP/P: likely pathogenic or pathogenic.
  • LB/B: likely benign or benign.
  • US: uncertain significance

Residue change: help From Glutamine (Q) to Histidine (H) at position 48 (Q48H, p.Gln48His). Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.
Physico-chemical properties: help Similar physico-chemical property. Both residues are medium size and polar. The physico-chemical property of the reference and variant residues and the change implicated.
BLOSUM score: help 0 The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:
  • Lowest score: -4 (low probability of substitution).
  • Highest score: 11 (high probability of substitution).
More information can be found on the following page

Variant description: help In GLC1A and GLC3A; the GLC3A patient also carries mutation H-368 in CYP1B1 suggesting digenic inheritance. Any additional useful information about the variant.
Other resources: help Links to websites of interest for the variant.


Sequence information Variant position: help 48 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Protein sequence length: help 504 The length of the canonical sequence.
Location on the sequence: help WDVGARTAQLRKANDQSGRC Q YTFSVASPNESSCPEQSQAM The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.
Residue conservation: help The multiple alignment of the region surrounding the variant against various orthologous sequences.
Human                         WDVGARTAQLRKANDQSGRC-------------------QYTFSVASPNESSCPEQSQAM

                              WGLEARTAQLRKANDRSGRC-------------------QY

Mouse                         WGMGARTAQFRKANDRSGRC-------------------QY

Rat                           WGMGARTAQFRKANDRSGRC-------------------QY

Bovine                        GGVGARTAQFQKANDRSGRC-------------------QY

Rabbit                        WGAGARTAQLRKANDRSGRC-------------------QY

Cat                           WGLGARTAQLRKANDRSGRC-------------------QY

Slime mold                    FAVAEQTYR-SMINEKENQCVIISGESGAGKTEAAKKIMQY

Sequence annotation in neighborhood: help The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:
  • Type: the type of sequence feature.
  • Positions: endpoints of the sequence feature.
  • Description: contains additional information about the feature.
TypePositionsDescription
Chain 33 – 504 Myocilin
Chain 33 – 226 Myocilin, N-terminal fragment
Glycosylation 57 – 57 N-linked (GlcNAc...) asparagine



Literature citations
Low frequency of myocilin mutations in Indian primary open-angle glaucoma patients.
Sripriya S.; Uthra S.; Sangeetha R.; George R.J.; Hemamalini A.; Paul P.G.; Amali J.; Vijaya L.; Kumaramanickavel G.;
Clin. Genet. 65:333-337(2004)
Cited for: VARIANT GLC1A HIS-48; VARIANT LYS-76; Myocilin gene implicated in primary congenital glaucoma.
Kaur K.; Reddy A.B.M.; Mukhopadhyay A.; Mandal A.K.; Hasnain S.E.; Ray K.; Thomas R.; Balasubramanian D.; Chakrabarti S.;
Clin. Genet. 67:335-340(2005)
Cited for: VARIANT GLC3A HIS-48;
Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.