Sequence information
Variant position: 77 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Protein sequence length: 504 The length of the canonical sequence.
Location on the sequence:
NESSCPEQSQAMSVIHNLQR
D SSTQRLDLEATKARLSSLES
The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.
Residue conservation: The multiple alignment of the region surrounding the variant against various orthologous sequences.
Human NESSCPEQSQAMSV--IHNLQ-------------------------------------RD SSTQRLDLEATKARLSSLES
NESSCPEQGQAMSA--IQDLQ--------------------
Mouse NESSCPREDQAMSA--IQDLQ--------------------
Rat SESSCPREDQAMSA--IQDLQ--------------------
Bovine SESSCPEQGQAMLA--IQELQ--------------------
Rabbit SESSCPEQGQTMSA--IQDLQ--------------------
Cat NESSCPEQGQAMSA--IQDLQ--------------------
Slime mold ENFAYLTKGDTLDIDGVDDVEEFALTRNAMNVIGIPANEQK
Sequence annotation in neighborhood: The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:Type: the type of sequence feature. Positions: endpoints of the sequence feature. Description: contains additional information about the feature.
Type Positions Description
Chain
33 – 504
Myocilin
Chain
33 – 226
Myocilin, N-terminal fragment
Coiled coil
74 – 184
Glycosylation
57 – 57
N-linked (GlcNAc...) asparagine
Literature citations
Founder TIGR/myocilin mutations for glaucoma in the Quebec population.
Faucher M.; Anctil J.-L.; Rodrigue M.-A.; Duchesne A.; Bergeron D.; Blondeau P.; Cote G.; Dubois S.; Bergeron J.; Arseneault R.; Morissette J.; Raymond V.;
Hum. Mol. Genet. 11:2077-2090(2002)
Cited for: VARIANTS GLC1A TRP-126; LYS-293; LYS-352; ARG-367; GLU-423; THR-427; VAL-445 AND LEU-481; VARIANTS LYS-76; GLU-77 AND ARG-398;
Disclaimer:
Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.