Expasy logo

UniProtKB/Swiss-Prot variant pages

UniProtKB/Swiss-Prot Q8NG31: Variant p.Met598Thr

Outer kinetochore KNL1 complex subunit KNL1
Gene: KNL1
Feedback?
Variant information Variant position: help 598 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Type of variant: help LB/B The variants are classified into three categories: LP/P, LB/B and US.
  • LP/P: likely pathogenic or pathogenic.
  • LB/B: likely benign or benign.
  • US: uncertain significance

Residue change: help From Methionine (M) to Threonine (T) at position 598 (M598T, p.Met598Thr). Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.
Physico-chemical properties: help Change from medium size and hydrophobic (M) to medium size and polar (T) The physico-chemical property of the reference and variant residues and the change implicated.
BLOSUM score: help -1 The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:
  • Lowest score: -4 (low probability of substitution).
  • Highest score: 11 (high probability of substitution).
More information can be found on the following page

Other resources: help Links to websites of interest for the variant.


Sequence information Variant position: help 598 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Protein sequence length: help 2342 The length of the canonical sequence.
Location on the sequence: help SNPLSISLTDRKTELLSGEN M DLTESHTSNLGSQVPLAAYN The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.
Residue conservation: help The multiple alignment of the region surrounding the variant against various orthologous sequences.
Human                         SNPLSISLTDRKTELLSGENMDLTESHTSNLGSQVPLAAYN

Mouse                         TNTLSVSLTDKKMEFLADEDMDLTKSHTTKLSQVIP-TTFD

Caenorhabditis elegans        -----------------NENNETARLFETTR---DPTLLYE

Baker's yeast                 -----------------GEPIDLTEYESKPY---VP----N

Fission yeast                 VYSLKAS----------HDPSNQTQLSSPNKSS-SPTSIEI

Sequence annotation in neighborhood: help The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:
  • Type: the type of sequence feature.
  • Positions: endpoints of the sequence feature.
  • Description: contains additional information about the feature.
TypePositionsDescription
Chain 1 – 2342 Outer kinetochore KNL1 complex subunit KNL1
Region 1 – 728 Interaction with BUB1 and BUB1B
Modified residue 578 – 578 Phosphoserine
Modified residue 584 – 584 Phosphoserine
Modified residue 586 – 586 Phosphothreonine



Literature citations
AF15q14, a novel partner gene fused to the MLL gene in an acute myeloid leukaemia with a t(11;15)(q23;q14).
Hayette S.; Tigaud I.; Vanier A.; Martel S.; Corbo L.; Charrin C.; Beillard E.; Deleage G.; Magaud J.-P.; Rimokh R.;
Oncogene 19:4446-4450(2000)
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 2 AND 4); CHROMOSOMAL TRANSLOCATION WITH KMT2A/MLL1; SUBCELLULAR LOCATION; TISSUE SPECIFICITY; VARIANTS SER-486; THR-598; GLY-936; GLU-1285 AND ALA-1473; Frequent expression of new cancer/testis gene D40/AF15q14 in lung cancer of smokers.
Takimoto M.; Wei G.; Dosaka-Akita H.; Mao P.; Kondo S.; Sakuragi N.; Chiba I.; Miura T.; Itoh N.; Sasao T.; Koya R.C.; Tsukamoto T.; Fujimoto S.; Kato H.; Kuzumaki N.;
Br. J. Cancer 86:1757-1762(2002)
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 3); TISSUE SPECIFICITY; VARIANTS THR-43; ALA-113; SER-486; THR-598 AND GLY-936; Characterization of the MLL partner gene AF15q14 involved in t(11;15)(q23;q14).
Kuefer M.U.; Chinwalla V.; Zeleznik-Le N.J.; Behm F.G.; Naeve C.W.; Rakestraw K.M.; Mukatira S.T.; Raimondi S.C.; Morris S.W.;
Oncogene 22:1418-1424(2003)
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1); CHROMOSOMAL TRANSLOCATION WITH KMT2A/MLL1; TISSUE SPECIFICITY; VARIANTS THR-598 AND GLY-936; DNA sequencing of a cytogenetically normal acute myeloid leukaemia genome.
Ley T.J.; Mardis E.R.; Ding L.; Fulton B.; McLellan M.D.; Chen K.; Dooling D.; Dunford-Shore B.H.; McGrath S.; Hickenbotham M.; Cook L.; Abbott R.; Larson D.E.; Koboldt D.C.; Pohl C.; Smith S.; Hawkins A.; Abbott S.; Locke D.; Hillier L.W.; Miner T.; Fulton L.; Magrini V.; Wylie T.; Glasscock J.; Conyers J.; Sander N.; Shi X.; Osborne J.R.; Minx P.; Gordon D.; Chinwalla A.; Zhao Y.; Ries R.E.; Payton J.E.; Westervelt P.; Tomasson M.H.; Watson M.; Baty J.; Ivanovich J.; Heath S.; Shannon W.D.; Nagarajan R.; Walter M.J.; Link D.C.; Graubert T.A.; DiPersio J.F.; Wilson R.K.;
Nature 456:66-72(2008)
Cited for: VARIANT [LARGE SCALE ANALYSIS] THR-598;
Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.