Expasy logo

UniProtKB/Swiss-Prot variant pages

UniProtKB/Swiss-Prot P43246: Variant p.His839Gln

DNA mismatch repair protein Msh2
Gene: MSH2
Feedback?
Variant information Variant position: help 839 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Type of variant: help LP/P [Disclaimer] The variants are classified into three categories: LP/P, LB/B and US.
  • LP/P: likely pathogenic or pathogenic.
  • LB/B: likely benign or benign.
  • US: uncertain significance

Residue change: help From Histidine (H) to Glutamine (Q) at position 839 (H839Q, p.His839Gln). Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.
Physico-chemical properties: help Similar physico-chemical property. Both residues are medium size and polar. The physico-chemical property of the reference and variant residues and the change implicated.
BLOSUM score: help 0 The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:
  • Lowest score: -4 (low probability of substitution).
  • Highest score: 11 (high probability of substitution).
More information can be found on the following page

Variant description: help In LYNCH1; has no effect on MSH2 splicing. Any additional useful information about the variant.
Other resources: help Links to websites of interest for the variant.


Sequence information Variant position: help 839 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Protein sequence length: help 934 The length of the canonical sequence.
Location on the sequence: help KGVCDQSFGIHVAELANFPK H VIECAKQKALELEEFQYIGE The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.
Residue conservation: help The multiple alignment of the region surrounding the variant against various orthologous sequences.
Human                         KGVCDQSFGIHVAELANFPKHVIECAKQKALELEEFQYIGE

Mouse                         KGVCDQSFGIHVAELANFPRHVIACAKQKALELEEFQNIGT

Rat                           TGVCDQSFGIHVAELANFPRHVIECAKQKALELEEFQSIGT

Bovine                        KGVCDQSFGIHVAELANFPRHVIECAKQKALELEEFQNIGK

Drosophila                    SGVMEKSFGIQVARLANFPEHVVQNAQEVYNEFED------

Slime mold                    QGPCDQSFGIHVAILANFPSQVIENAKQKAKELESFESNTL

Baker's yeast                 PGISDQSFGIHVAEVVQFPEKIVKMAKRKANELDDLKTNNE

Fission yeast                 EGASDRSFGIHVAKLAHFPPKIIEMASNKAAELEA-EDSGA

Sequence annotation in neighborhood: help The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:
  • Type: the type of sequence feature.
  • Positions: endpoints of the sequence feature.
  • Description: contains additional information about the feature.
TypePositionsDescription
Chain 2 – 934 DNA mismatch repair protein Msh2
Modified residue 845 – 845 N6-acetyllysine
Modified residue 847 – 847 N6-acetyllysine
Cross 845 – 845 Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)
Cross 847 – 847 Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)
Mutagenesis 845 – 845 K -> R. Reduces interaction with MSH6. Reduces acetylation; when associated with R-847, R-871 and R-892.
Mutagenesis 847 – 847 K -> R. Reduces interaction with MSH6. Reduces acetylation; when associated with R-845, R-871 and R-892.
Helix 838 – 851



Literature citations
A large fraction of unclassified variants of the mismatch repair genes MLH1 and MSH2 is associated with splicing defects.
Tournier I.; Vezain M.; Martins A.; Charbonnier F.; Baert-Desurmont S.; Olschwang S.; Wang Q.; Buisine M.P.; Soret J.; Tazi J.; Frebourg T.; Tosi M.;
Hum. Mutat. 29:1412-1424(2008)
Cited for: VARIANTS LYNCH1 LEU-92 DEL; ARG-199; ASP-331; GLU-470; ASN-610; GLY-638; GLU-645; LEU-696; TYR-748 AND GLN-839; VARIANTS VAL-272; ASN-596 DEL; TYR-671; ARG-697 AND PHE-723; CHARACTERIZATION OF VARIANTS LYNCH1 LEU-92 DEL; ARG-199; ASP-331; GLU-470; ASN-610; GLY-638; GLU-645; LEU-696; TYR-748 AND GLN-839; CHARACTERIZATION OF VARIANTS VAL-272; ASN-596 DEL; TYR-671; ARG-697 AND PHE-723;
Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.