UniProtKB/Swiss-Prot P18577: Variant p.Ser330Tyr

• Variant information
• Sequence information
• Literature citations
• All

Variant information

Variant position: 330 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Type of variant: LB/B The variants are classified into three categories: LP/P, LB/B and US.

• LP/P: likely pathogenic or pathogenic.
• LB/B: likely benign or benign.
• US: uncertain significance

Residue change: From Serine (S) to Tyrosine (Y) at position 330 (S330Y, p.Ser330Tyr). Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.
Physico-chemical properties: Change from small size and polar (S) to large size and aromatic (Y) The physico-chemical property of the reference and variant residues and the change implicated.
BLOSUM score: -2 The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:

• Lowest score: -4 (low probability of substitution).
• Highest score: 11 (high probability of substitution).

More information can be found on the following page
Polymorphism: RhCE and RhD are responsible for the RH blood group system. The molecular basis of the E=Rh3/e=Rh5 blood group antigens is a single variation in position 226; Pro-226 corresponds to Rh3 and Ala-226 to Rh5. Variant p.Trp16Cys is associated with altered expression of E antigen. The molecular basis of the C=Rh2/c=Rh4 blood group antigens are variations in position 16, 60, 68 and 103; p.Cys16Trp, p.Ile60Leu, p.Ser68Asn and p.Ser103Pro are found in antigen Rh4. Additional information on the polymorphism described.
Other resources: Links to websites of interest for the variant.

• Variant rs1053372 [ dbSNP | Ensembl ]

Sequence information

Variant position: 330 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Protein sequence length: 417 The length of the canonical sequence.
Location on the sequence: KCLPVCCNRVLGIHHISVMH S IFSLLGLLGEITYIVLLVLH The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.
Sequence annotation in neighborhood: The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:

• Type: the type of sequence feature.
• Positions: endpoints of the sequence feature.
• Description: contains additional information about the feature.

Type	Positions	Description
Chain	2 – 417	Blood group Rh(CE) polypeptide
Alternative sequence	163 – 409	Missing. In isoform 8h.
Alternative sequence	204 – 417	Missing. In isoform 8e.
Alternative sequence	212 – 384	Missing. In isoform 4g.
Alternative sequence	243 – 417	Missing. In isoform RhPI-Alpha.
Alternative sequence	309 – 417	Missing. In isoform 2e.
Alternative sequence	314 – 409	Missing. In isoform 1h.
Alternative sequence	314 – 354	VCCNRVLGIHHISVMHSIFSLLGLLGEITYIVLLVLHTVWN -> DWLPGPPQHWGTQLGHRDSSHVWSPDRFAPKSQNMESTSCG. In isoform RHIV.
Helix	327 – 347

Literature citations

No reference for the current variant in UniProtKB/Swiss-Prot.