Expasy logo

UniProtKB/Swiss-Prot variant pages

UniProtKB/Swiss-Prot Q9NP94: Variant p.Phe115Leu

Zinc transporter ZIP2
Gene: SLC39A2
Feedback?
Variant information Variant position: help 115 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Type of variant: help LB/B The variants are classified into three categories: LP/P, LB/B and US.
  • LP/P: likely pathogenic or pathogenic.
  • LB/B: likely benign or benign.
  • US: uncertain significance

Residue change: help From Phenylalanine (F) to Leucine (L) at position 115 (F115L, p.Phe115Leu). Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.
Physico-chemical properties: help Change from large size and aromatic (F) to medium size and hydrophobic (L) The physico-chemical property of the reference and variant residues and the change implicated.
BLOSUM score: help 0 The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:
  • Lowest score: -4 (low probability of substitution).
  • Highest score: 11 (high probability of substitution).
More information can be found on the following page

Other resources: help Links to websites of interest for the variant.


Sequence information Variant position: help 115 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Protein sequence length: help 309 The length of the canonical sequence.
Location on the sequence: help ADSAHMEYPYGELIISLGFF F VFFLESLALQCCPGAAGGST The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.
Residue conservation: help The multiple alignment of the region surrounding the variant against various orthologous sequences.
Human                         ADSAHMEYPYGELIISLGFFFVFFLESLALQCCPGAAGGST

Mouse                         AASSYVEYPYGELVISLGFFFVFLLESLALQCCHGAAGGST

Sequence annotation in neighborhood: help The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:
  • Type: the type of sequence feature.
  • Positions: endpoints of the sequence feature.
  • Description: contains additional information about the feature.
TypePositionsDescription
Chain 1 – 309 Zinc transporter ZIP2
Transmembrane 104 – 124 Helical
Alternative sequence 86 – 309 Missing. In isoform 2.
Mutagenesis 106 – 106 E -> A. Decreased of about 30% in transport activity.
Mutagenesis 106 – 106 E -> Q. Increased of about 35% in transport activity.
Mutagenesis 120 – 120 E -> A. Does not affect pH sensitivity.



Literature citations
Subtraction cloning of growth arrest inducible genes in normal human epithelial cells.
Yamaguchi S.;
Kokubyo Gakkai Zasshi 62:78-93(1995)
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1); VARIANT LEU-115; Functional expression of the human hZIP2 zinc transporter.
Gaither L.A.; Eide D.J.;
J. Biol. Chem. 275:5560-5564(2000)
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1); FUNCTION; VARIANT LEU-115; TISSUE SPECIFICITY; BIOPHYSICOCHEMICAL PROPERTIES; SUBCELLULAR LOCATION; The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
The MGC Project Team;
Genome Res. 14:2121-2127(2004)
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1); VARIANT LEU-115;
Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.