Expasy logo

UniProtKB/Swiss-Prot variant pages

UniProtKB/Swiss-Prot P62807: Variant p.Gly27Ser

Histone H2B type 1-C/E/F/G/I
Gene: H2BC10
Feedback?
Variant information Variant position: help 27 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Type of variant: help LB/B The variants are classified into three categories: LP/P, LB/B and US.
  • LP/P: likely pathogenic or pathogenic.
  • LB/B: likely benign or benign.
  • US: uncertain significance
Residue change: help From Glycine (G) to Serine (S) at position 27 (G27S, p.Gly27Ser). Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.
Physico-chemical properties: help Change from glycine (G) to small size and polar (S) The physico-chemical property of the reference and variant residues and the change implicated.
BLOSUM score: help 0 The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:
  • Lowest score: -4 (low probability of substitution).
  • Highest score: 11 (high probability of substitution).
More information can be found on the following page
Other resources: help Links to websites of interest for the variant.


Sequence information Variant position: help 27 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Protein sequence length: help 126 The length of the canonical sequence.
Location on the sequence: help SAPAPKKGSKKAVTKAQKKD G KKRKRSRKESYSVYVYKVLK The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.
Residue conservation: help The multiple alignment of the region surrounding the variant against various orthologous sequences. 
Human                         SAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSVYVYKVLK

Mouse                         SAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSVYVYKVLK
Sequence annotation in neighborhood: help The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:
  • Type: the type of sequence feature.
  • Positions: endpoints of the sequence feature.
  • Description: contains additional information about the feature.
TypePositionsDescription
Chain 2 – 126 Histone H2B type 1-C/E/F/G/I
Region 1 – 36 Disordered
Compositional bias 17 – 35 Basic residues
Modified residue 7 – 7 ADP-ribosylserine
Modified residue 12 – 12 N6-(beta-hydroxybutyryl)lysine; alternate
Modified residue 12 – 12 N6-acetyllysine; alternate
Modified residue 12 – 12 N6-crotonyllysine; alternate
Modified residue 12 – 12 N6-lactoyllysine; alternate
Modified residue 13 – 13 N6-(2-hydroxyisobutyryl)lysine; alternate
Modified residue 13 – 13 N6-acetyllysine; alternate
Modified residue 13 – 13 N6-crotonyllysine; alternate
Modified residue 15 – 15 Phosphoserine; by STK4/MST1
Modified residue 16 – 16 N6-acetyllysine; alternate
Modified residue 16 – 16 N6-crotonyllysine; alternate
Modified residue 16 – 16 N6-lactoyllysine; alternate
Modified residue 17 – 17 N6-(beta-hydroxybutyryl)lysine; alternate
Modified residue 17 – 17 N6-acetyllysine; alternate
Modified residue 17 – 17 N6-crotonyllysine; alternate
Modified residue 17 – 17 N6-glutaryllysine; alternate
Modified residue 17 – 17 N6-lactoyllysine; alternate
Modified residue 21 – 21 N6-(2-hydroxyisobutyryl)lysine; alternate
Modified residue 21 – 21 N6-(beta-hydroxybutyryl)lysine; alternate
Modified residue 21 – 21 N6-acetyllysine; alternate
Modified residue 21 – 21 N6-butyryllysine; alternate
Modified residue 21 – 21 N6-crotonyllysine; alternate
Modified residue 21 – 21 N6-lactoyllysine; alternate
Modified residue 24 – 24 N6-(2-hydroxyisobutyryl)lysine; alternate
Modified residue 24 – 24 N6-acetyllysine; alternate
Modified residue 24 – 24 N6-crotonyllysine; alternate
Modified residue 24 – 24 N6-lactoyllysine; alternate
Modified residue 25 – 25 N6-(2-hydroxyisobutyryl)lysine
Modified residue 35 – 35 N6-(2-hydroxyisobutyryl)lysine; alternate
Modified residue 35 – 35 N6-(beta-hydroxybutyryl)lysine; alternate
Modified residue 35 – 35 N6-crotonyllysine; alternate
Modified residue 35 – 35 N6-glutaryllysine; alternate
Modified residue 35 – 35 N6-succinyllysine; alternate
Modified residue 36 – 36 PolyADP-ribosyl glutamic acid
Modified residue 37 – 37 Phosphoserine; by AMPK
Modified residue 44 – 44 N6-(2-hydroxyisobutyryl)lysine; alternate
Modified residue 44 – 44 N6-glutaryllysine; alternate
Modified residue 44 – 44 N6-lactoyllysine; alternate
Modified residue 47 – 47 N6-(2-hydroxyisobutyryl)lysine; alternate
Modified residue 47 – 47 N6-glutaryllysine; alternate
Modified residue 47 – 47 N6-methyllysine; alternate
Cross 21 – 21 Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2); alternate
Cross 35 – 35 Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin); alternate



Literature citations
Human histone gene organization: nonregular arrangement within a large cluster.
Albig W.; Kioschis P.; Poustka A.; Meergans K.; Doenecke D.;
Genomics 40:314-322(1997)
Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] (H2BC4; H2BC6; H2BC7 AND H2BC10); VARIANT SER-27;
Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.