Home  |  Contact

UniProtKB/Swiss-Prot P00973: Variant p.Arg361Thr

2'-5'-oligoadenylate synthase 1
Gene: OAS1
Variant information

Variant position:  361
The position of the amino-acid change on the UniProtKB canonical protein sequence.

Type of variant:  Polymorphism
The variants are classified into three categories: Disease, Polymorphism and Unclassified.
  • Disease: Variants implicated in disease according to literature reports.
  • Polymorphism: Variants not reported to be implicated in disease.
  • Unclassified: Variants with uncertain implication in disease according to literature reports. Evidence against or in favor of a pathogenic role is limited and/or conflicting.

Residue change:  From Arginine (R) to Threonine (T) at position 361 (R361T, p.Arg361Thr).
Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.

Physico-chemical properties:  Change from large size and basic (R) to medium size and polar (T)
The physico-chemical property of the reference and variant residues and the change implicated.

BLOSUM score:  -1
The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:
  • Lowest score: -4 (low probability of substitution).
  • Highest score: 11 (high probability of substitution).
More information can be found on the following page

Other resources:  
Links to websites of interest for the variant.



Sequence information

Variant position:  361
The position of the amino-acid change on the UniProtKB canonical protein sequence.

Protein sequence length:  400
The length of the canonical sequence.

Location on the sequence:   SSWILLAESNSADDETDDPR  R YQKYGYIGTHEYPHFSHRPS
The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.

Sequence annotation in neighborhood:  
The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:
  • Type: the type of sequence feature.
  • Positions: endpoints of the sequence feature.
  • Description: contains additional information about the feature.

TypePositionsDescription
Chain 1 – 400 2'-5'-oligoadenylate synthase 1
Alternative sequence 347 – 400 AESNSADDETDDPRRYQKYGYIGTHEYPHFSHRPSTLQAASTPQAEEDWTCTIL -> TQHTPGSIHPTGRRGLDLHHPLNASASWGKGLQCYLDQFLHFQVGLLIQRGQSSSVSWCIIQDRTQVS. In isoform p48.
Alternative sequence 347 – 382 AESNSADDETDDPRRYQKYGYIGTHEYPHFSHRPST -> VNLTLVGRRNYPIISEHAVNLQQTRRASLSYSFQVA. In isoform p44.
Alternative sequence 347 – 364 AESNSADDETDDPRRYQK -> VRPPASSLPFIPAPLHEA. In isoform p41.


Literature citations

Structure of two forms of the interferon-induced (2'-5') oligo A synthetase of human cells based on cDNAs and gene sequences.
Benech P.; Mory Y.; Revel M.; Chebath J.;
EMBO J. 4:2249-2256(1985)
Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA / MRNA] (ISOFORMS P41 AND P46); VARIANTS ASP-31; SER-162; THR-352 AND THR-361;

The mammalian 2'-5' oligoadenylate synthetase gene family: evidence for concerted evolution of paralogous Oas1 genes in Rodentia and Artiodactyla.
Perelygin A.A.; Zharkikh A.A.; Scherbik S.V.; Brinton M.A.;
J. Mol. Evol. 63:562-576(2006)
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM P48); VARIANTS SER-162; THR-352 AND THR-361;

Susceptibility to infection by West Nile Virus: OAS1 (OAS1 2'-5' oligoadenylate synthetase gene) stop codon detected in exon 1 of a normal individual heterozygous for the gene.
Lee M.-K.; Morshed M.G.; Jorgensen D.R.; Hasselback P.; Goh S.-H.;
Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] (ISOFORM P46); VARIANTS THR-352 AND THR-361;

Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.