Expasy logo

UniProtKB/Swiss-Prot variant pages

UniProtKB/Swiss-Prot P40259: Variant p.Gly137Ser

B-cell antigen receptor complex-associated protein beta chain
Gene: CD79B
Feedback?
Variant information Variant position: help 137 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Type of variant: help LP/P [Disclaimer] The variants are classified into three categories: LP/P, LB/B and US.
  • LP/P: likely pathogenic or pathogenic.
  • LB/B: likely benign or benign.
  • US: uncertain significance
Residue change: help From Glycine (G) to Serine (S) at position 137 (G137S, p.Gly137Ser). Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.
Physico-chemical properties: help Change from glycine (G) to small size and polar (S) The physico-chemical property of the reference and variant residues and the change implicated.
BLOSUM score: help 0 The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:
  • Lowest score: -4 (low probability of substitution).
  • Highest score: 11 (high probability of substitution).
More information can be found on the following page
Variant description: help In AGM6. Any additional useful information about the variant.
Other resources: help Links to websites of interest for the variant.


Sequence information Variant position: help 137 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Protein sequence length: help 229 The length of the canonical sequence.
Location on the sequence: help NGIYFCQQKCNNTSEVYQGC G TELRVMGFSTLAQLKQRNTL The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.
Residue conservation: help The multiple alignment of the region surrounding the variant against various orthologous sequences. 
Human                         NGIYFCQQKCNNTS-EVYQGCGTELRVMGFSTLAQLKQRNTL

Mouse                         NGIYFCKQKCDSANHNVTDSCGTELLVLGFSTLDQLKRRNT
Sequence annotation in neighborhood: help The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:
  • Type: the type of sequence feature.
  • Positions: endpoints of the sequence feature.
  • Description: contains additional information about the feature.
TypePositionsDescription
Chain 29 – 229 B-cell antigen receptor complex-associated protein beta chain
Topological domain 29 – 159 Extracellular
Domain 38 – 138 Ig-like V-type
Glycosylation 127 – 127 N-linked (GlcNAc...) asparagine
Glycosylation 128 – 128 N-linked (GlcNAc...) asparagine
Disulfide bond 136 – 136 Interchain (with C-119 in alpha chain)
Alternative sequence 41 – 144 Missing. In isoform Short.



Literature citations
A hypomorphic mutation in Igbeta (CD79b) in a patient with immunodeficiency and a leaky defect in B cell development.
Dobbs A.K.; Yang T.; Farmer D.; Kager L.; Parolini O.; Conley M.E.;
J. Immunol. 179:2055-2059(2007)
Cited for: VARIANT AGM6 SER-137;
Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.